Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

88 results about "Analgesic Preparation" patented technology

Natural or synthetic compound mixtures, Analgesic Preparations relieve pain by altering the perception of nociceptive stimuli without loss of consciousness. Analgesic compounds may act at opioid receptors (morphine-like drugs) or at other central or peripheral sites (non-steroidal anti-inflammatory agents). (NCI04)

Oral delayed immediate release formulation and method for preparing the same

The invention relates to an Oral Delayed Immediate Release formulation comprising a compressed core containing one or more active substances surrounded with a coating, wherein release of active substance from the core is caused by rupture of the coating after a definite lag-time, said core comprising one or more immediate release carriers and having no substantial swelling properties upon exposure to gastrointestinal fluids. The invention further relates to formulations containing an Immediate Release formulation combined with one or more Oral Delayed Immediate Release formulations with different lag-times and to a method of preparing an Oral Delayed Immediate Release formulation.The Oral Delayed Immediate Release formulation may be used for the application of active substances whenever a certain lag-time before release is advantageous, such as in be the case of anti-asthmatics, anti-emetics, cardiotonics, vasodilators, anti-vertigo and anti-meniere compounds, anti-hypertensives, sedatives, anti-depressants, anti-anxiety compounds, cortico-steroids, general anti-inflammatory compounds, anti-inflammatory compounds for gastrointestinal use, anti-ulceratives, analgetics, anti-aritmics, anti-rheumatics, anti-arthritic compounds and anti-angina compounds.The Oral Delayed Immediate Release formulation may also be used for the application of biological active compounds such as proteins, peptides, enzymes, vaccines and oligonucleotides.
Owner:ABBOTT PROD OPERATION AG

Preparation of opioid analgesics by a one-pot process

A one-pot process for preparing opioid analgesics such as hydrocodone, hydromorphone, and analogues thereof by reacting codeine, morphine, and analogues thereof with hydrogen in a solvent system of benzophenone and neutral solvent in the presence of a metal catalyst followed by oxidation in the presence of potassium tert-alkylate.
Owner:ACURA PHARMA

Anti-inflammatory analgesic

The present invention is concerned with an anti-inflammation analgesic preparation which contains a specific 3-0-substituted ascorbic acid as an active ingredient, shows excellent anti-inflammation analgesic effects and is excellent in shelf life, safety to a skin and endermic absorptivity of the active ingredient.
Owner:NIPPON HYPOX LAB INC

Topical Analgesic for Sensitive Skin

A topical analgesic for sensitive skin for providing a fast-acting and deeply penetrating topical analgesic that does not irritate sensitive skin teaching a chemical composition consisting of one or more herbs containing the properties of an analgesic such as those selected from a group of herbs containing methyl salicylate, salicin, or menthol, including birch bark, wintergreen, willow bark meadowsweet and peppermint or any other herbs with analgesic properties, such as but not limited to, lavender, Arnica Montana, passion flower, calendula, chamomile; a transdermal agent, such as Arnica Montana; one or more herbs containing the properties of an anti-inflammatory, such as lavender or birch bark; Myrrh; and a base to hold the ingredients together and make it applicable to skin. The topical analgesic may also include a natural preservative to increase product stability and shelf life and one or more essential oils for added pain relief using olfactory senses.
Owner:WARD AURELIA L +1

Effective parts of cirald daphne bark, preparation method and application thereof

The invention relates to the effective site of bark of girald daphne, process for preparation and use thereof, wherein the effective site is obtained through extracting with water or water-containing lower alcohol, and refining with resin. The obtained medicament comprises daphnetin, daphnoretin, daphnetoxin and total coumarin. The obtained effective site can be used for antiphlogistic and analgesic functions and can be prepared into oral preparation, injection, and externally used preparation.
Owner:GUANGZHOU LIXIN PHARM CO LTD

Anti-inflammation analgesic preparation

The present invention is concerned with an anti-inflammation analgesic preparation which contains a specific 3-0-substituted ascorbic acid as an active ingredient, shows excellent anti-inflammation analgesic effects and is excellent in shelf life, safety to a skin and endermic absorptivity of the active ingredient.
Owner:NIPPON HYPOX LAB INC

Method for preparing bacterial cellulose slow-release analgesia dressing

The invention discloses a method for preparing a bacterial cellulose slow-release analgesia dressing and relates to the technical field of medical apparatus and instruments and preparation thereof. The method comprises the following steps: uniformly dispersing analgesics in a chitosan solution to obtain a solution A, and mixing an organic solution and a surfactant to obtain a solution B; slowly dropping the solution B into the solution A in a water bath, and performing high-speed stirring to obtain stable water-in-oil (W / O) emulsion; washing the emulsion in a shock chilling water bath, and separating to obtain chitosan slow-release microspheres which have uniform particle size and are encapsulated with the analgesics; and uniformly dripping the chitosan slow-release microspheres on a bacterial cellulose film modified by carboxymethyl cellulose, and performing freeze drying to obtain the bacterial cellulose slow-release analgesia dressing. The method is simple and feasible in preparation process, convenient in operation and low in cost; and the prepared slow-release dressing has the multiple effects of slowly releasing the analgesics, sterilizing, moisturizing, ventilating, absorbing wound exudate and the like and can relieve skin injury and postoperative incisional pain and cure various skin wounds.
Owner:钟春燕

Method for preparing composite delayed-release prepn. of non-narcotic analgesic

A composite slow-release non-stupefacient sedative contains fast-release component (25-75%), slow-release component (25-75%), colloidal polymer (6-50%) and enteric coating material (5-40%). Its preparing process is also disclosed.
Owner:王鸣

Preparation method of ropivacaine methanesulfonate and its compound and preparation

InactiveCN1517337ADoes not affect optical rotation measurementsImprove solubilityNervous disorderOrganic chemistryKetone solventsFormamide
A ropivacaine methanesulfonate as anesthetic or analgetic has a chemical formula: (-)-(S)-N-(2,6-dimethylphenyl)-1-propyl piperidine-2-formamide methanesulfonate, and is prepared through preparing raw materials, dissolving, adding, methane sulfonic acid, adding ketone solvent, filtering, baking and recrystallizing. Its advantages are high stability and output rate and low cost.
Owner:ZHEJIANG XIANJU PHARMA

Application of Cortex Ilicis Rotundae saponin compound in preparing anti-inflammatory and analgetic medicament

The invention provides an application of a Cortex Ilicis Rotundae saponin compound in preparing an anti-inflammatory and analgetic medicament, relates to the field of medicine and particularly relates to an application of a Cortex Ilicis Rotundae saponin compound. The Cortex Ilicis Rotundae saponin compound can be used for preparing the anti-inflammatory and analgetic medicament, wherein the Cortex Ilicis Rotundae saponin compound is shown in a formula disclosed in the specification, wherein R is H or / and R is beta-D-glucose. In terms of the extraction of the active components of the medicament, raw materials can be obtained easily, the process is simple, the operation is convenient, and batch production can be realized; the product quality can be controlled easily; and the anti-inflammatory and analgetic medicament is low in toxicity, less in side effect and effective.
Owner:安士制药(中山)有限公司

Lappaconitine hydrochoric acid, its production method and its uses in preparing analgetic

The invention discloses a manufacturing method of alcaine high-sinomontanine and application in the anodyne, which comprises the following steps: dissolving high-sinomontanine through alcohol or carbinol; dripping alcaine solution; stewing; eluting; crystallizing; filtering; washing crystallization through little solvent; drying.
Owner:韦璧瑜 +1

Preparation and application of conotoxin striatus S21a in South China Sea

InactiveCN102154301AImproved expression methodNervous disorderPeptide/protein ingredientsCDNA libraryProtein target
The invention relates to a preparation method and an application of conotoxin striatus gene S21.1 in the South China Sea and the coded polypeptide S21a of the conotoxin striatus gene S21.1. According to the invention, a cDNA (complementary deoxyribonucleic acid) library is constructed, and the conotoxin striatus gene S21.1 is obtained by cloning in a tube of conus striatus in the South China Sea.The invention provides a preparation method of the polypeptide, which comprises the following steps: connecting the conotoxin gene S21.1 and a vector pTRX to obtain a recombinant expression vector pTRX-S21.1; transforming the recombinant expression vector pTRX-S21.1 into host bacteria and culturing and expressing in the host bacteria; and separating and purifying the recombinant fusion protein ofthe expression product to obtain the target protein, namely the polypeptide S21a. The polypeptide S21a provided by the invention has the functions of blocking neurotransmitter transfer and easing pains, and can be used for preparing tool medicines and analgesic medicines in neurobiology research.
Owner:SUN YAT SEN UNIV

External application for pain relief and preparation method thereof

The invention discloses an externally applying medicine for relieving pain and a preparation method thereof. The externally applying medicine for relieving pain comprises the following ingredients in percentage by weight: 10 to 26 percent of medicinal oil, 0.03 to 0.08 percent of borneol, 5 to 10 percent of active carbon, 50 to 70 percent of reduced iron powder, 1 to 2.7 percent of edible salt, 1 to 2.7 percent of absorptive resin and 10 to 26 percent of purified water, wherein the medicinal oil comprises the following ingredients in percentage by volume: 10 to 40 percent of peppermint oil, 10 to 40 percent of cinnamon oil, 10 to 40 percent of eucalyptus oil, 10 to 40 percent of blumea oil, 10 to 30 percent of eugenol type basil oil and 10 to 40 percent of safflower oil. The externally applying medicine for relieving pain has the advantages that: the medicinal oil is used for replacing the traditional medicine, has volatility and is volatile oil; and after the medicinal oil is bound with heating materials such as the reduced iron powder and the like, the medicine can be absorbed by skin better depending on heating and volatility of the medicine, so the curative effect of the medicine is exerted to the maximum degree, and various kinds of pain, in particular pain of neck, shoulder, waist, legs and the like caused by cold symptoms, can be treated.
Owner:曾爱忠

Amide compound, preparation method and application thereof

The invention discloses an amide compound, a preparation method and application thereof, and particularly provides a compound as shown in a formula (I), or a salt thereof, or an isotope replacement form thereof, or an optical isomer thereof, or a solvate thereof, or a crystal form thereof, or a prodrug thereof. According to the invention, the local anesthetic effect duration of the compound provided by the invention is obviously longer than that of a contrast drug bupivacaine; and compared with bupivacaine, the compound provided by the invention is higher in titer and better in safety, can bedecomposed and removed from plasma more quickly, and has a very good application prospect in preparation of local anesthetic drugs or local analgesic drugs.
Owner:WEST CHINA HOSPITAL SICHUAN UNIV

A kind of preparation method and application of duck foot veneer extract

The invention discloses a method for preparing a taxillus chinensis danser extract, an extract and application. The method comprises the following steps of: taking an ethanol extract of taxillus chinensis danser powder; sequentially extracting by using petroleum ether, chloroform, ethyl acetate and n-butyl alcohol; respectively mixing various extract liquor and aqueous solution; and decompressingand recovering solvent to obtain a petroleum ether extract, a chloroform extract, an ethyl acetate extract and an n-butyl alcohol extract. The taxillus chinensis danser extract disclosed by the invention has good anti-inflammatory analgesic activity and can be applied to preparing anti-inflammatory analgesic drugs.
Owner:GUANGDONG PHARMA UNIV

1,3-bis(beta-amino acrylate) substituted imidazole compound as well as preparation method and application thereof

The invention belongs to the field of high polymer materials, and discloses a 1,3-bis(beta-amino acrylate) substituted imidazole compound as well as a preparation method and application thereof. The structure of the compound is shown in the specification. The 1,3-bis(beta-amino acrylate) substituted imidazole compound has a certain antibacterial property, oxidation resistance, an anti-inflammatoryeffect, an anti-parasitic effect, and the like. Therefore, the compound is expected to be developed into novel antibacterial drugs, anti-inflammatory and analgesic drugs, anti-parasitic drugs and free radical scavengers. The preparation method of the 1,3-bis(beta-amino acrylate) substituted imidazole compound has the advantages that raw materials and the catalyst are cheap and easy to obtain; thereaction conditions are mild, and the operation is simple and convenient. The substrate range is wide, the functional group compatibility is good, and a high yield of a series of 1,3-bis(beta-amino acrylate) substituted imidazole products is achieved.
Owner:GUANGZHOU UNIVERSITY

Method for obtaining series analgesic active peptides DKK and analogs thereof and application of series analgesic active peptide DKK and analogs thereof

The invention belongs to the field of medical biotechnology, and relates to series analgesic active peptides DKK and analogs thereof, a method for obtaining the series analgesic active peptides DKK and the analogs thereof, and application of series analgesic active peptide DKK and the analogs thereof as analgesic medicaments in the field of medicaments. The analgesic active peptides comprise the following amino acid sequences respectively: DGYIRGSNGCKISCLWGNEGCNKECKGFGAYYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK; DGYIRGSNGCKVSCLWGNDGCNKECRAYGASYGYCWTWGLACWCEGLPDDKTWKSESNTCGGK; DGYIRGSNGCKISCLWGNEGCNKECIGFGAYYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK; and DGYIRGSNGCKVSCLLGNEGCNKECRAYGASYGYCWTWKLACWCQGLPDDKTWKSESNTCGGKK. The series analgesic active peptides DKK and derivatives thereof or analogs or active fragments can be obtained by using technical expressions of gene engineering and have a simple obtaining method, and an obtained product has good analgesic activity.
Owner:SHENYANG PHARMA UNIVERSITY

Diclofenac epolamine jellies, preparing method and uses thereof

The invention relates to a non-steroidal anti-inflammatory demulcent drug, which is a diclofenac epolamine gel preparation for relieving moderate pain in muscles, soft tissues and articulations. The gel preparation adopts 0.1-8.0 percent (weight percentage) of diclofenac epolamine as a main activated ingredient, 0-20 percent of grease, 0-5 percent of surfactant, 5-20 percent of cosolvent, a pH regulator, 5-20 percent of bacteriostat, 0.5-2.0 percent of gel substrate, etc. and purified water. PH value of the preparation is 6.0-8.0. The invention also provides a preparation method of the gel. The gel preparation of the invention has the advantages of good stability and good skin coupling effect, and can promote absorption of the skin to the drug and improve bioavailability and curative effect; at the same time, the substrate has stable property and no irritation to the skin, can be easily smeared and washed, has no greasiness, is beneficial to releasing of drug, especially water soluble drug and has good safety and clinical practicability.
Owner:SHANGHAI HUILUN BIOLOGICAL TECH CO LTD +1

Ibuprofen medicinal preparation and preparing method thereof

The invention relates to an analgesic-antipyretic ibuprofen pharmaceutical preparation and process for preparation, which comprises ibuprofen and medicinal supplementary materials, the medicament can be made into aerosol which comprises 0.8-10 weight portions of ibuprofen as raw material, 5-95 weight portions of medicinal auxiliary material, and 5-90 weight portions of casting agent.
Owner:湖北南洋药业有限公司

Analgesic compound traditional Chinese medicine essential oil composition and preparation methods of preparations thereof

The invention provides an analgesic compound traditional Chinese medicine essential oil composition and preparation methods of preparations thereof. The analgesic compound traditional Chinese medicineessential oil composition is prepared from the following components by weight: 5-10 parts of olibanum essential oil, 5-15 parts of myrrh essential oil, 10-18 parts of folium artemisiae argyi essential oil, 5-10 parts of herba asari essential oil, 12-25 parts of zingiberis rhizoma essential oil, 5-12 parts of herba menthae essential oil, 5-10 parts of Chinese ilex leaf essential oil and 15-30 parts of geranium essential oil. The invention further provides preparation methods of analgesic preparations of the composition, including emulsifiable paste, an ointment and spray. According to the analgesic compound traditional Chinese medicine essential oil composition and the preparation methods of the preparations thereof, it is found through research that after the olibanum essential oil, the myrrh essential oil, the folium artemisiae argyi essential oil, the herba asari essential oil, the herba menthae essential oil, the Chinese ilex leaf essential oil and the geranium essential oil are made into the emulsifiable paste, the ointment and the spray, after use at the specific dosages, arthralgia can be effectively relieved, and thus the emulsifiable paste, the ointment and the spray havethe analgesia efficacy.
Owner:JIANGXI UNIVERSITY OF TRADITIONAL CHINESE MEDICINE

Process for Synthesizing Remifentanil

InactiveUS20080319196A1Nervous disorderOrganic chemistryOpiateRemifentanil
An improved process for synthesizing opiate or opioid analgesics and anesthetics, and intermediates thereof is provided. In particular, processes of synthesizing intermediates for use in the preparation of synthetic opiate or opioid compounds such as, for example, remifentanil, carfentanil, sufentanil, fentanyl, and alfentanil are disclosed. The preparation process requires fewer steps, and results in reduced costs and higher efficiency than processes known in the art for producing remifentanil and carfentanil.
Owner:MALLINCKRODT INC

Novel conus P-superfamily toxin sequence, preparation method and uses thereof

The invention discloses a new gene Lt16.1 of M-superfamily conotoxins of signal conus collected form South China Sea, a polypeptide sequence 1t16a coded by the same, a method for preparing the same and application of the polypeptide in the researche of neurobiology and ion channel as well as in the development of analgesics. The invention provides a new gene Lt16.1 of M-superfamily conotoxins found in a poison canal of signal conus from South China Sea by means of constructing cDNA library and clones a full-length gene by RT-PCR method. The amino acid sequence of the precursor of the polypeptide 1t16a is shown in a sequence list as and 1t; 400 and gt;2 sequence. The amino acid sequence of a mature peptide is shown the sequence list as &1t; 400 and gt; 3 sequence. The recombinant conotoxin 1t16a can obviously block part of sodium channels, provided the concentration is below 0.1um so as to reduce a peak current of sodium channels. The recombinant conotoxin 1t16a has analgesic effect on central nervous system by the mouse hot plate experiment.
Owner:SUN YAT SEN UNIV

Preparation method of 1,3-disubstituted-3-aryl propylene compound and application thereof

The invention discloses a preparation method of a 1,3-disubstituted-3-aryl propylene compound and an application thereof. A palladium complex, which is generated by coordination between Pd(OAc)2 and a ligand, is used as a catalyst, and an allyl carbonic ester compound reacts with an aryl boric acid compound to prepare the 1,3-disubstituted-3-aryl propylene compound. The palladium catalyst used in the method is easy to obtain; the reaction condition is mild; a chiral substrate can be utilized to obtain a configuration-reversed chiral product and the chiral conversion rate is high; and the obtained 1,3-disubstituted-3-aryl propylene compound is easy for conversion and derivatization, and can be used to prepare an aryl propionic acid anti-inflammatory and analgesic medicine.
Owner:SHANGHAI JIAO TONG UNIV

Bupleurum antipyretic and analgesic preparation and technology for preparing same

ActiveCN102631386AEnhance antipyretic and analgesic effectGuaranteed stabilityAntipyreticAnalgesicsMedicineAnalgesic Preparation
The invention relates to the field of Chinese medicinal preparation, and particularly discloses a bupleurum antipyretic and analgesic preparation and a technology for preparing the same. The bupleurum antipyretic and analgesic preparation contains bupleurum essential oil, saikoside and pharmaceutical adjuvant, wherein the volume to weight ratio of the bupleurum essential oil and the saikoside is 1 / 0.5-10(ml / g). Preferably, the volume to weight ratio of the bupleurum essential oil and the saikoside is 1 / 1-6(ml / g). Meanwhile, the invention discloses a technology for preparing the bupleurum antipyretic and analgesic preparation. The bupleurum antipyretic and analgesic preparation provided in the invention has obvious antipyretic and analgesic effects, and has wide administration routes.
Owner:SICHUAN DE PEI YUAN TRADITIONAL CHINESE MEDICINE SCI & TECH DEV CO LTD

Method for detecting COX-2 enzymatic activity in process of evaluating analgesic effect of drug

The invention relates to a method for detecting COX-2 enzymatic activity in a process of evaluating analgesic effect of a drug. The method is characterized by comprising the following steps: performing COX-2 enzymatic activity inhibition detection on the drug; and performing data processing and potency calculation on a COX-2 enzymatic activity detection result, so as to determine the analgesic effect of the drug. By utilizing a traditional Chinese medicine quality evaluation method provided by the invention and based on biological potency can perform quality evaluation on Chinese and Western analgesics or active components provided with corresponding targets, like a cassia twig tuckahoe preparation or an extract of cassia twig and tuckahoe, quality of the drug can be better controlled, andclinical medication effectiveness is guaranteed.
Owner:JIANGSU KANION PHARMA CO LTD +1

Tapentadol carbamate derivative and preparation method and application thereof

The invention belongs to the field of pharmacy, in particular to a tapentadol carbamate derivative with a general formula I, pharmaceutically acceptable salts, a preparation method and an application thereof. In the invention, the structure of phenolic hydroxyl groups in tapentadol molecules is improved by a chemical synthesis method, and proper carrier groups are introduced in the position to synthesize carbamate type prodrug. All amines adopted by the carbamate are fatty amines, wherein dimethylamine or methylamine fragments can generate demethylation metabolism easily in vivo, thereby being convenient for releasing raw tapentadol. Meanwhile, the existence of the carbamate structure increases the chemical stability of the prodrug and can obviously improve the oral bioavailability, reduce the administration dosage and lower the toxic side effect, and the tapentadol carbamate derivative can be further developed into novel tapentadol analgesics.
Owner:SHENYANG PHARMA UNIVERSITY +1

Compounded analgesic preparation containing cobratide and oxycodone

ActiveCN104645312ARapid time to peak plasma concentrationLong time to peak plasma concentrationOrganic active ingredientsPowder deliverySciaticaAnalgesic Preparation
The invention discloses a compounded analgesic preparation containing cobratide and oxycodone, which includes following raw materials, by weight, 0.04-0.08 parts of the cobratide and 4-12 parts of an oxycodone active component. The oxycodone active component is the oxycodone and a pharmaceutically-acceptable salt thereof. An experimental result proves that the compounded analgesic preparation can alleviate terminal cancer pain, chronic joint pain, sciatica, neuropathic headache, prosopalgia and lepra reaction neuralgia and the like chronic pains, is especially suitable for chronic, refractory and durable pains, is quick in effect, is strong and durable in analgesic effect, can avoid or reduce addiction and dependency and is high in stability. The compounded analgesic preparation containing the cobratide and the oxycodone can be used as an ideal medicine for cancer-used analgesia.
Owner:GUIZHOU YIBAI PHARMA CO LTD

Treatment of sunburn using analgesics and antihistamines

ActiveUS20120225914A1Safe and effective and convenient treatmentTreat sunburnBiocideSmall article dispensingSunburnAnalgesic agents
Combination compositions and kits comprising an analgesic and an antihistamine are provided as well as methods of use in treating sunburn.
Owner:SEPHORIS PHARMA

Method For Treating Pruritus

Benzomorphan compounds are found to be useful for treating, ameliorating or preventing pruritus, and in particular pruritus associated with (including induced by) the administration of opioids. Antipruritic activity is believed to be mediated through the dual action of the compounds as mu opioid receptor antagonists and kappa opioid receptor agonists. Pharmaceutical compositions contain therapeutically effective amounts of these useful compounds, optionally in combination with second therapeutic agents, such as opioid or non-opioid analgesics or other compounds.
Owner:EURO-CELTIQUE SA

South China sea conus littertus linnaeus nervotoxin and its coding sequence and use

The present invention discloses South China Sea Conuslittertus Linnaeus nervotoxin and its coding sequence and use, and is especially one kind of South China Sea Conuslittertus Linnaeus nervotoxin gene 1t14.1 its coded polypeptide 1t14a, and the application of the polypeptide in preparing tool medicine for neurobiology research and analgesic. By means of cDNA library constituting process, the present invention clones new super family member 1t14.1 of conotoxin from South China Sea Conuslittertus Linnaeus poison canal with the DNA sequence as shown in <400>1 of the sequence list. The gene coded polypeptide, nervotoxin 1t14a, has precursor peptide and conjectural mature peptide with the amino acid sequence as shown in <400>2 of the sequence list. The nervotoxin 1t14a of the present invention can block the transmitter transfer between nerve and muscular joint, has analgesic effect and may be used in preparing tool medicine for neurobiology research and analgesic.
Owner:SUN YAT SEN UNIV
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More