Product
Patsnap Eureka
For R&D, Patsnap Eureka makes reading and utilizing patents & technical documents easy.
Patsnap Eureka AIR
Designed for self-driven R&D workflows. Generate viable solutions, solve complex R&D challenges, empower your innovation with AI.
Patsnap Eureka Materials
Designed for material experts only. Revolutionize your material R&D, from search, analyze, to developing new materials.
Feature
TechResearch
Generate reliable direction feasibility study reports for your R&D in just a few steps.
TechSeek
Discover and master advanced knowledge NOW. Basics, ideas, possibilities, all at once.
TechMind
As an expert in R&D Theories, TechMind can generates customized viable solutions instantly.
TechRisk
Analyze your overall solution with one click, know your potential R&D risks in advance.
TechMonitor
Get weekly tech updates, stay abreast of the latest tech innovations and key insights.
Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
451 results about "Intestinal adenocarcinoma" patented technology
Efficacy Topic
Property
Owner
Technical Advancement
Application Domain
Technology Topic
Technology Field Word
Patent Country/Region
Patent Type
Patent Status
Application Year
Inventor
Gastric adenocarcinoma is a malignant epithelial tumour, originating from glandular epithelium of the gastric mucosa. Stomach cancers are overwhelmingly adenocarcinomas (90%). Histologically, there are two major types of gastric adenocarcinoma (Lauren classification): intestinal type or diffuse type.
Biological compositions and methods for treatment of stomach cancer
The present invention relates to pharmaceutical compositions and dietary supplement comprising yeast cells that can produce a healthful benefit in a subject inflicted with stomach cancer. The biological compositions can be used to retard the growth of stomach cancer cells and / or prolonging the time of survival of the subject. The invention also relates to methods for manufacturing the biological compositions.
Owner:ULTRA BIOTECH
Anti-Claudin 3 Monoclonal Antibody and Treatment and Diagnosis of Cancer Using the Same
InactiveUS20100111852A1Inhibit cell proliferationIn-vivo radioactive preparationsBiological material analysisProstate cancerCytotoxicity
Monoclonal antibodies that bind specifically to Claudin 3 expressed on cell surface are provided. The antibodies of the present invention are useful for diagnosis of cancers that have enhanced expression of Claudin 3, such as ovarian cancer, prostate cancer, breast cancer, uterine cancer, liver cancer, lung cancer, pancreatic cancer, stomach cancer, bladder cancer, and colon cancer. The present invention provides monoclonal antibodies showing cytotoxic effects against cells of these cancers. Methods for inducing cell injury in Claudin 3-expressing cells and methods for suppressing proliferation of Claudin 3-expressing cells by contacting Claudin 3-expressing cells with a Claudin 3-binding antibody are disclosed. The present application also discloses methods for diagnosis or treatment of cancers.
Owner:CHUGAI PHARMA CO LTD
Treatment of Helicobacter with isothiocyanates
The present invention relates to methods of preventing or inhibiting the growth of Helicobacter through the use of a composition that comprises a glucosinolate, an isothiocyanate or a derivative or metabolite thereof. The present invention also relates to methods of preventing or treating persistent chronic gastritis, ulcers and / or stomach cancer in subjects at risk for, or in need of treatment thereof.
Owner:BRASSICA FOUND FOR CHEMOPROTECTION RES
Pro108 antibody compositions and methods of use and use of Pro108 to assess cancer risk
InactiveUS7294704B2Reduce riskHigh profileAnimal cellsImmunoglobulins against cell receptors/antigens/surface-determinantsCancer cellMammal
Owner:DIAZYME LAB INC
Recombinant human Claudin18.2 tumor vaccine and preparation method thereof
InactiveCN101584860AImprove securitySimple manufacturing methodMicroorganism based processesAntibody medical ingredientsSide effectMouse Stomach
The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.
Owner:西安杰诺瓦生物科技有限公司
LncRNA combination for detecting prognosis condition of stomach cancer and kit containing combination
InactiveCN107488740AAvoid detection errorsImprove accuracyMicrobiological testing/measurementDNA/RNA fragmentationMissed diagnosisOncology
The invention discloses an LncRNA combination for detecting a prognosis condition of stomach cancer and a kit containing the combination. According to the invention, a fluorescent quantitation PCR or digital PCR technique is adopted to identify the difference change of a set of specific LncRNA expression quantity in a stomach cancer patient sample (tissue, plasma, serum, gastric juice, and the like) and a corresponding paracancerous sample or normal sample and to early and accurately evaluate the risk of stomach cancer relapse or transfer. The kit disclosed by the invention provides a biomarker LncRNA combination for detecting the prognosis condition of stomach cancer, a primer for detecting the LncRNA contained in the combination and a related reagent, so that the kit is capable of effectively increasing the detection efficiency and accuracy for the stomach cancer prognosis relapse or transfer. The invention adopts a set of prognosis transfer related LncRNA combination for avoiding the defect of great increasing of the fault diagnosis rate and missed diagnosis rate of the stomach cancer diagnosis caused by lower sensitivity and specificity resulted from a detection index LncRNA served as a tumor marker kit.
Owner:NANYANG NORMAL UNIV
Traditional Chinese medicine composition for treating tumours and preparation method thereof
ActiveCN101683359ASignificant effectGood treatment effectAmphibian material medical ingredientsOrganic active ingredientsMedicinal herbsAnticarcinogenic Effect
The invention discloses a traditional Chinese medicine composition for treating tumours and a preparation method thereof. The traditional Chinese medicine composition contains a bufogenin extract anda medicinal carrier, wherein the bufogenin extract is prepared by the purification of a silica gel column after being extracted by a toad venom medicinal material, the total content is not below 92%,and then the traditional Chinese medicine composition is prepared by dissolution, filtration, encapsulation and sterilization and can be further prepared into a liquor for injection or freeze-drying powder injection. The traditional Chinese medicine composition has a favorable anticancer action for lung cancer, liver cancer, mammary cancer, stomach cancer, colonic cancer and the like, can increaseleucocyte and has less side effect.
Owner:SHANGHAI CHENPON PHARM TECH CO LTD +1
Nitrogen-atom-containing arteannuin dimers, and preparation method and application thereof
The invention relates to nitrogen-atom-containing arteannuin dimers disclosed as Formula (1) and pharmaceutically acceptable salts thereof, wherein X is NR, NR(CH2)nNR or a formula disclosed in the specification; R is H or C14 alkyl group; Y and Z are respectively (CH2)m, (CH2)n(OCH2CH2)m, OC(CH2)nCO or COAr; Ar is phenyl group, naphthyl group or heterocyclic group; N is a 2-8 whole number, and mis a 1-11 whole number; and the heterocyclic group is quinary or sexenary, and contains 1-2 heteroatoms selected from N, O and S. The invention also provides a preparation method of the nitrogen-atom-containing arteannuin dimers, a pharmaceutical composition of the nitrogen-atom-containing arteannuin dimers, and application of the nitrogen-atom-containing arteannuin dimers in preparing drugs for treating cancers, especially endometrial carcinoma, oophoroma, cervical carcinoma, breast cancer, colon cancer, lung cancer, prostatic cancer, liver cancer and / or stomach cancer.
Owner:SHANGHAI INST OF MATERIA MEDICA CHINESE ACAD OF SCI +1
Preparation method and application of sandwich type immunosensor for detecting stomach cancer tumor marker
ActiveCN108802133AIncrease loadGood loading capacityMaterial electrochemical variablesAbnormal tissue growthSandwich type
The invention relates to a preparation method and application of a sandwich type immunosensor for detecting a stomach cancer tumor marker, and belongs to the field of novel nano functional materials,immunoassay and biological sensors. Three-dimensional porous molybdenum disulfide loading gold nano particle h-MoS2 / Au NPs is prepared to serve as a substrate material to modify a bare glassy carbon electrode, the solid supporting amount of the tumor marker to capture antibody is improved, and the electron transferring rate of electrode surface is effectively accelerated; an octahedral cuprous oxide / titanium dioxide core-shell structure loading mesoporous platinoid nano particle Cu2O@TiO2 / PtCu composite nano material is prepared to immobilize and detect the antibody, and the simple, rapid andsensitive sandwich type electrochemical immunosensor is prepared by utilizing the excellent electrochemical catalytic property of the composite nano material to hydrogen peroxide H2O2, and the immunosensor is used for detecting related tumor markers of stomach cancer.
Owner:UNIV OF JINAN
Application of mitoxantrone as lymph tracer
ActiveCN102397561ALow toxicityNo allergiesIn-vivo testing preparationsOXALIC ACID DIHYDRATEEthylic acid
The invention provides an application of mitoxantrone and salt thereof as a lymph tracer (such as hydrochloric acid mitoxantrone, oxalic acid mitoxantrone, sulfuric acid mitoxantrone, phosphoric acid mitoxantrone, acetic acid mitoxantrone, citric acid mitoxantrone and the like). The mitoxantrone and salt thereof can be used for preparing injection, powder injection, emulsion, liposome, nanoparticle, microballoon and the like. The mitoxantrone and salt thereof not only can be used for killing malignant tumor cells, but also the blue dye feature can be used as the lymph tracer applied to lymphadenectomy in cancer operative treatment, which is suitable for treating stomach cancer, breast cancer, intestinal cancer, cervical carcinoma, testis cancer and the like.
Owner:SHENYANG PHARMA UNIVERSITY +1
Chinese-medicinal composition for treating chronic gastritis and atrophic gastritis and its production
ActiveCN1981860ADefinite curative effectPrevent gastric cancerPowder deliveryDigestive systemCurative effectLiquorices
A Chinese medicine in the form of particles for treating chronic gastritis and chronic atrophic gastritis and preventing stomach cancer is prepared from 10 Chinese-medicinal materials including notoginseng, white peony root, dandelion herb, liquorice root, etc. Its preparing process is also disclosed.
Owner:SINOPHARM GRP DEZHONG (FOSHAN) PHARM CO LTD +1
Methods and compositions for treating inflammatory disorders of the gastrointestinal tract
The present invention provides compositions and methods for treating or preventing the development of inflammatory disorder of the gastrointestinal tract in a subject, comprising administering to a subject therapeutically effective amount of a biologically active mixture of high purity, high molecular weight straight chain primary aliphatic alcohols (referred to collectively herein as policosanol). Inflammatory conditions that can be addressed by the compositions and methods of this invention include colorectal cancer, neoplasm of the colon, neoplasm of the rectum, ulcerative colitis, adenomatous polyps, familial polyposis, stomach cancer, and combinations thereof.
Owner:WYETH LLC
Long noncoding RNA (LncRNA), and primer pair and kit for detecting expression level of long noncoding RNA in cells and tissues
ActiveCN104877998AOriginalSimple and fast operationMicrobiological testing/measurementDNA/RNA fragmentationCarcinomaBiology
The invention provides a new long noncoding RNA (LncRNA) Lnc21q22.11 sequence, and a primer pair and kit for detecting expression level of the long noncoding RNA in cells and tissues. The full length of the LncRNA Lnc21q22.11 is identified to be 1202bp for the first time, the specific primers are utilized for the first time to detect the expression level of the LncRNA Lnc21q22.11 in stomach cancer cells, 35 pairs of stomach cancer line and para-carcinoma tissues, colorectal cancer cell lines and 10 pairs of colorectal cancer and para-carcinoma tissues, and thus, the kit is creative. The detection of the expression of the LncRNA Lnc21q22.11 in the stomach cancer tissues by using the kit and specific primers can be used as an effective means for stomach cancer and colorectal cancer diagnosis, curative effect observation, prognosis judgment, focus residue and relapse detection and the like. The kit is simple to operate, has the advantages of high stability and high sensitivity, and has far-reaching clinical meanings and popularization performance.
Owner:GENERAL HOSPITAL OF PLA
Anti-LFL2 antibodies for the diagnosis, prognosis and treatment of cancer
ActiveUS20050260212A1Useful in therapyAnimal cellsImmunoglobulins against cell receptors/antigens/surface-determinantsAbnormal tissue growthCancer targeting
Particular anti-LFL2 antibody compositions are provided herein. These antibodies may be used for diagnosis, prognosis, therapeutic monitoring and treatment of cancer, especially breast cancer, head / neck cancer, lung cancer, ovarian cancer, stomach cancer and pancreatic cancer. Furthermore, anti-LFL2 antibodies are provided herein which target the LFL2 stump remaining after proteolytic cleavage of the extracellular domain of LFL2. Additionally, anti-LFL2 antibodies are provided herein which target the stroma surrounding cancer tumors, wherein said stroma-targeting anti-LFL2 antibodies disrupt the integrity of the stroma surrounding the cancer tumor, and also make the stroma more permeable to chemotherapeutic agents and other molecular drug agents that target tumor cells.
Owner:ABBVIE BIOTHERAPEUTICS
Nitrogen-containing aromatic heterocyclic compound
Provided is a compound useful as a prophylactic and / or therapeutic agent for bladder cancer.As a result of studies on compounds having FGFR inhibitory action, the present inventors have found that the nitrogen-containing aromatic heterocyclic compounds of the present invention have inhibitory action on FGFR1, FGFR2, and / or FGFR3, particularly, mutant FGFR3, and thus, the present invention has been accomplished. The nitrogen-containing aromatic heterocyclic compound of the present invention can be used as a therapeutic agent for various cancers related to FGFR1, FGFR2, and / or FGFR3, such as lung cancer and hormone therapy-resistant breast cancer, stomach cancer, triple negative breast cancer, endometrial cancer, bladder cancer, and glioblastoma, particularly as a prophylactic and / or therapeutic agent for mutant FGFR3-positive bladder cancer.
Owner:ASTELLAS PHARMA INC +1
Construction method and application of a stomach cancer image recognition model
PendingCN109584218AImproved preprocessing methodAccurate identificationImage enhancementImage analysisLesion siteRadiology
Owner:BEIJING FRIENDSHIP HOSPITAL CAPITAL MEDICAL UNIV +1
Pharmaceutical composition for treating chronic atrophic gastritis
ActiveCN101406599AImprove clinical symptomsSymptoms improvedDigestive systemGranular deliveryWeaknessStomach cancer
The invention provides a medicine composition for treating chronic atrophic gastritis, which has the advantages of obvious curative effect and convenient carrying. The medicine composition can not only improve various clinical symptoms of the chronic atrophic gastritis, but also improve intestinal metaplasia and heterotypic hyperplasia accompanying the chronic atrophic gastritis, thereby realizing stomach cancer prevention by the medicine. The medicine composition is prepared by the extracts of roasted milkvetch root, radix codonopsis pilosulae, dried orange peel, nutagrass flatsedge rhizome, white peony root, Chinese yam, black plum and liquorice; the preparation process is simple and is suitable for mass production; the clinical tests show that the preparation 'stomach nourishing granules' prepared by the technical proposal can fully improve various symptoms of the chronic atrophic gastritis, achieve the aim of clinical curing, and has more stable efficacies in particular to the chronic atrophic gastritis caused by weakness of the spleen and the stomach or weakness of the spleen and the stomach and qi stasis.
Owner:CHIATAI QINGCHUNBAO PHARMA
Applications of four gypenoside compounds to preparation of medicament for treating tumors
InactiveCN102579471AEnhanced inhibitory effectOrganic active ingredientsSteroidsOncologyWilms' tumor
The invention relates to a gynostemma pentaphyllum leaf extract which is rich in damulin A, damulin b, gypenoside L and gypenoside LI, and applications of four saponin compounds to preparation of a medicament for treating tumors. Cancers are selected from lung cancer, stomach cancer, liver cancer, breast cancer or leukemia.
Owner:MINZU UNIVERSITY OF CHINA
Deuterium-Enriched Pyrimidine Compounds and Derivatives
The present invention is concerned with deuterium-enriched pyrimidine compounds of formula I, their derivatives, enantiomers, diastereomers, solvates and pharmaceutical salts thereof,and their uses in the treatment, prevention and modulation of various diseases including chronic liver diseases, liver cirrhosis, liver fibrosis, hepatocellular carcinoma, liver cancer, renal cell carcinoma, kidney cancer, colorectal cancer, brain cancer, breast cancer, blood cancer, lung cancer, thyroid cancer, ovarian cancer, pancreas cancer, prostate cancer, stomach cancer, testicular cancer, uterus cancer, intestinal cancer, skin cancer, and other forms of cancer, carcinoid tumors, teratocarcinoma, tumor progression, metastasis and fibrosis in the neuroendocrine neoplasia, fibrotic processes as well as a disease state modulated directly or indirectly with 5-HT receptors, 5-HT1, 5-HT1A, 5-HT2 receptors, 5-HT2A and 5-HT2B receptors, dopamine receptors and multiple kinase pathways.
Owner:DHANOA DALJIT SINGH
Solanum dulcamara total-saponin extract and preparation method and use thereof
The invention provides a solanum dulcamara total saponins extract containing 10-90% of solanum dulcamara total saponins by weight, which is a total steroidal saponins made from traditional Chinese medicine solanum dulcamara by process of extracting, separating and refining. Animal tests shows that: the exact has substantial effects of anti-inflammatory, anti-tumor, helicobacter pylori inhibition, gastric mucosa protection and keratinocyte proliferation inhibition, can be used in the preparation of medicaments for treating gastritis, stomach and duodenal ulcer stomach cancer and psoriasis.
Owner:SUNDIA MEDITECH COMPANY LTD
Preparation for antibody of antineoplastic specificity marker protein TS/MEDP and use thereof
The invention discloses the specificity marker protein TS / MEDP antibody preparation and the purpose. The molecular biology technology is utilized, and a new gene is cloned in a stomach cancer cell and is named as TS / MDEP. A polyclonal antibody for preventing the TS / MDEP is prepared, and a high specificity antibody is acquired through the antibody purification technology. The expression characteristics of the TS / MDEP gene in a tumor cell line and a tumor cell tissue are verified from the mRNA and protein level, the expression in 14 tumor cell lines including the tumor cell line is determined, the dependance of cell cycle is assumed, the excess expression exists in stomach cancer, breast cancer and cervical cancer tissues, no expression is in the corresponding normal tissues, and the expression exists in an embryo tissue. The high expression of the TS / MDEP in the embryo tissue with exuberant cell proliferation is validated, after growing up, the gene is closed, and the high expression exists in the tumor cells. The TS / MDEP has the seasonal specificity expression to clew the occurrence and the development of the cell cycle control abnormity caused by the high expression of the TS / MDEP. The obtained antibody for preventing the TS / MDEP can be used to monitor the cell cycle advancement and the clinical biological behavior of the gastroenteric tumor.
Owner:BEIJING CANCER HOSPITAL PEKING UNIV CANCER HOSPITAL
Lectin microarray for detecting carbohydrate chain marker based on sialoprotein and detection method of carbohydrate chain marker using same
The invention relates to a lectin microarray for detecting a carbohydrate chain marker based on sialoprotein and a detection method of the carbohydrate chain marker using the same. The lectin microarray can nondestructively detect the carbohydrate chain marker by distinguishing sialoprotein. The lectin microarray comprises a testing lectin probe group, wherein the testing lectin probe group comprises a vicia villosa lectin, an aleuria aurantia lectin, a pea lectin, a winged bean lectin-II an a winged bean lectin-I, and the winged bean lectin-II and the winged bean lectin-I are used as internal reference lectins. The lectin microarray has the advantages that the human body is not injured when the carbohydrate chain marker for detecting the carbohydrate chain marker is harmless to a human body, less samples are used, the detection speed is high and the sensitivity is high, and the lectin microarray can be applied to identification of stomach cancer.
Owner:深圳格道糖生物技术有限公司
Renshujianwei granules stomachia and its preparation method
InactiveCN1410099AGood effectImprove utilization and stabilityDigestive systemUnknown materialsAdemetionineStomach cancer
A Chinese medicine in the form of granules for treating chronic atrophic gastritis and lesion before stomach cancer is prepared from 8 Chinese medicinal materials including astragalus root, white atractylodes rhizome, coix seed, scutellaria root, etc. through pretreating, extracting effective components, concentrating, pulverizing, coating, mixing, granulating and packaging. Its advantages are high curative effect and no toxic by-effect.
Owner:NANJING ZHONGSHAN PHARM CO LTD
Seprase as a marker for cancer
ActiveUS20100240081A1Decreased concentration and activityMicrobiological testing/measurementBiological material analysisPancreas CancersCancer type
The present invention relates to a method aiding in the assessment of cancer. It discloses the use of the human fibroblast activation protein (FAP / seprase) as a universal marker of different cancer types. Seprase aids in the assessment of pulmonary or lung cancer (LC) or of colon cancer, e.g., of non-small cell lung carcinoma (NSCLC) or colorectal cancer (CRC), but also likely of other specific types of cancer. Such specific cancer types are, e.g., esophagus, head and neck cancer, stomach cancer, bile duct cancer, pancreas cancer, kidney cancer, cervix cancer, ovary cancer, breast cancer, bladder cancer, endometrium cancer or prostate cancer. Furthermore, it especially relates to a method for assessing cancer from a liquid sample, derived from an individual by measuring seprase in said sample. Measurement of seprase can, e.g., be used in the early detection of cancer or in the surveillance of patients who undergo surgery.
Owner:ROCHE DIAGNOSTICS OPERATIONS INC +1
Drug delivery polymers and uses thereof
ActiveUS10105449B2Reduces and avoids symptom and causeGood curative effectHeavy metal active ingredientsPowder deliveryPancreas CancersProstate cancer
Described herein are platinum-based brush-arm star polymers (Pt-BASPs), or a pharmaceutical composition thereof, for delivery of platinum-based agents, such as oxaliplatin. Also provided are methods and kits involving the Pt-BASPs, or a pharmaceutical composition thereof, for treating proliferative diseases such as cancers (e.g., lung cancer, head-and-neck cancer, esophagus cancer, stomach cancer, breast cancer, pancreas cancer, colorectal cancer, liver cancer, kidney cancer, or prostate cancer) in a subject.
Owner:MASSACHUSETTS INST OF TECH
Blood vessel formation inhibitor IIM3 and its preparation method and application
InactiveCN1830487AImprove and enhance growthImprove and enhance the anti-tumor effectPeptide/protein ingredientsAntineoplastic agentsEscherichia coliInclusion bodies
An efficient angiogenesis depressant HM-3 for treating the solid tumors including stomach cancer, lung cancer and liver cancer is prepared through expressing in colibacillus by genetic engineering method, separating the protein of inclusion body, dissolving, re-naturalizing, and separating-purifying by ion change and chromatography.
Owner:徐寒梅
Soap pod saponin extract as well as preparation method and application thereof
InactiveCN101537036ASynergistic effect is obviousProlong survival timeAntineoplastic agentsPlant ingredientsSide effectComplete remission
The invention discloses a soap pod saponin extract, a preparation method thereof and an application for curing lung cancer, liver cancer, stomach cancer, colorectal cancer and leukemia. The soap pod saponin extract uses fructus gleditsiae or fructus gleditsiae sinensis as the raw material and is prepared by the extraction of ethanol, and the separation and the purification of macroporous resin, and the content of total saponin of the extract is more than 60 percent. The saponin extract mainly comprises various pentacyclic triterpene saponin compounds, has obvious lethal effect on the clone of the leukemia progranulocyte HL-60 and the stomach cancer transferring lymphocyte SGC7901 of people, and has remarkably inhibited effect on the tumor of mice S180 and mice having the liver cancer. When capsules prepared by the extract are used for curing 40 examples having liver cancer, lung cancer, stomach cancer and colorectal cancer, the partial remission rate is 45 percent, and the partial remission and stabilization rate is 72.5 percent. When the capsules are used for curing 30 patients who have leukemia, the complete remission rate is 66.7 percent, and the total remission rate is 90 percent which is better than that of a single chemo-treatment group. The extract can obviously lighten the toxic side effect caused by the chemo-treatment.
Owner:SHANDONG ACAD OF CHINESE MEDICINE
Antineoplastic composition and use thereof
InactiveCN101332301AIncreased drug resistanceEnhanced inhibitory effectHeavy metal active ingredientsAntineoplastic agentsMalignant lymphomaProstate cancer
The invention discloses an anti-tumor combination and the application thereof; the anti-tumor combination which includes effective dose of platinum-based chemotherapy and AKT inhibitor and / or p70S6K1 inhibitor has the function of inhibiting the drug resistance of the tumor to the platinum-based chemotherapy, improves the effects of anti-tumor drugs, and can be used for preparing drugs that can resist various tumors, such as lung cancer, ovarian cancer, prostate cancer, breast cancer, stomach cancer, nasopharyngeal cancer, esophageal cancer, malignant lymphoma, head and neck squamous cell carcinoma, thyroid cancer, osteosarcoma, etc.
Owner:NANJING MEDICAL UNIV
Compounds that inhibit hif-1 activity, the method for preparation thereof and the pharmaceutical composition containing them as an effective component
InactiveUS20090306078A1Inhibit expressionInhibit growthBiocideOrganic chemistryDiabetic retinopathyLymphatic Spread
Disclosed herein are an HIF-1 inhibitor, a method for the preparation thereof, and a pharmaceutical composition comprising the same as an active ingredient. The HIF-1 inhibitor shows anticancer activity thanks to the inhibition activity against HIF-1, a transcription factor which plays an important role in the growth and metastasis of cancer, but not to general cytotoxicity. Thus, the HIF-inhibitor and a pharmaceutically acceptable salt thereof can be used as a therapeutic for various cancers such as liver cancer; stomach cancer and breast cancer. Also, the compound having inhibition activity against HIF-1 is useful in the treatment of diabetic retinopathy and arthritis, which are aggravated by HIF-1-mediated VEGF expression.
Owner:KOREA RES INST OF BIOSCI & BIOTECH
Dolysaccharide nanometer anticancer material and its preparation method
InactiveCN1559614AResolve separabilitySolving Purification ProblemsOrganic active ingredientsPowder deliveryDrugStomach cancer
A nano-class anticancer polyose material for treating stomach cancer, intestine cancer and liver cancer is prepared from chitosan as basic raw material.
Owner:ZHEJIANG UNIV
Who we serve
- R&D Engineer
- R&D Manager
- IP Professional
Why Patsnap Eureka
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com