Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

95 results about "Scorpion Venoms" patented technology

Venoms from animals of the order Scorpionida of the class Arachnida. They contain neuro- and hemotoxins, enzymes, and various other factors that may release acetylcholine and catecholamines from nerve endings. Of the several protein toxins that have been characterized, most are immunogenic.

Scorpion analgesic antibacterial active peptide and preparation method thereof

The invention discloses a structure, function and making method of karsch analgesic antibiotic active peptide, whose amino acid sequence is NGYLLDKYTGCKVWCVINNESCNSECKIRGG-YYGYCYFWK LACFCQGARNSELWNYNTNKCNGKL, wherein the active peptide or derivant or analog can be synthesized through gene engineering technique, which solves the difficulty to separate and purify peptide; the active peptide is mixed with multiple carriers as medical acceptable agent, which is fit for clinical.
Owner:SHENYANG PHARMA UNIVERSITY

Abc transporter ligand

Compositions and methods of using scorpion venom peptide that is a ligand for ABC transporters. One aspect provides a peptide having at least 80% sequence identity to SEQ ID NO: 1. The peptide Is believed to have a molecular mass of about 3.7 kDa and specifically interacts with cystic fibrosis transmembrane conductance regulator. Methods of treating a disorder or symptom of a disorder related to aberrant ABC transporter activity are also provided.
Owner:GEORGIA TECH RES CORP

Scorpion venom heat-resisting polypeptide, and preparing method and applications thereof

InactiveCN104341495AGood effectDefine pharmacodynamic activity and pharmacodynamic targetsNervous disorderPeptide/protein ingredientsDiseaseMedicine
The invention provides a scorpion venom heat-resisting polypeptide, and a preparing method and applications thereof, and belongs to the field of polypeptide and preparation thereof. The scorpion venom heat-resisting polypeptide which is safer is obtained by removing heat-resisting and heat-labile toxic components mainly from the scorpion venom of buthus martensii kirsch (BmK). The polypeptide is used for preventing and treating intractable epilepsy, Parkinson's disease (PD), Alzheimer's disease (AD), and other diseases, has a common function target, and has respective special medicine effects. Preparation of the polypeptide is stable in process, simple and controllable.
Owner:张万琴

Enhanced targeted drug delivery system via chitosan hydrogel and chlorotoxin

Specific drug delivery to tumor cells without affecting normal cells is a major challenge in cancer treatment. The present invention incorporates embedding nonionic surfactant vesicles (niosomes) containing an anti-cancer therapeutic agent with chlorotoxin into a thermosensitive chitosan hydrogel network. Chitosan has mucoadhesive property which can be used in the targeting of the tumor cells with the mucin over expression. Chlorotoxin is a 36 amino acid peptide obtained from Leiurus quinquestriatus scorpion venom which binds preferentially to tumor cells of neuroectodermal origin but not to normal cells. The incorporation of chlorotoxin along with niosomes in the chitosan hydrogel is used as the second targeting strategy to further improve the specific delivery of drugs to tumor cells such as glioma.
Owner:UNIV OF SOUTH FLORIDA

Katsutoxin extract, preparation method and application thereof

The invention discloses a scorpion venom extract extracted from East Asia scorpions. A preparation method for the scorpion venom extract comprises the following steps: scorpion venom freeze-dried powder is dissolved, centrifuged, filtered by use of 0.45 mu m and 0.22 mu m microporous membranes and freeze-dried; sephadex is added in; III-IV protein peaks of scorpion venom are collected; cation exchange chromatography is carried out; detection is carried out by use of an ultraviolet spectrophotometer; and the protein peaks are collected, so as to obtain the scorpion venom extract. Experiments prove that the scorpion venom extract has definite functions of inhibiting angiogenesis and hepatoma cell reincrease value. The invention successfully extracts effective components inhibiting angiogenesis and hepatoma cell reincrease value from the East Asia scorpions, which provides a foundation for further research and application in the future.
Owner:INST OF BASIC MEDICINE OF SAMS

Buthotoxin polypeptide and preparation method thereof

The present invention relates to a scorpion venom polypeptide and its perparation method, belonging to the field of biological pharmaceutical technology. The scorpion venom polypeptide extracted by using HPLC has the characteristics of strong activity, high purity, stable quality and controllable components, and has the good effect of stopping pain, resisting platelet aggregation and stopping drugs.
Owner:沈阳成泰实业有限公司

Five-poison chicken for preventing and treating cancer and preparation method

The preparation method of five-venom chicken for preventing and curing cancers includes: respectively extracting snake venom, scorpion venom, centipede venom, house lizard venom and toad venom, mixing them and injecting them into poisonous snake body, using said poisonous snake as carrier of venom, feeding it into the crop of live cock, after the poisonous snake is digested and absorbed by said live cock and the venom is bio-converted, the cock can be choked to death, processed and eaten by cancer's pateint. Said invention can raise immunity of patient, can be used for curing cancer of lung, carcinoma of esophagus, carcinoma of stomach and intestinal cancer, etc..
Owner:贾玉山

Polarized Scorpion Venom Solution and a Method for Making Polarized Scorpion Venom Solution

Various embodiments of this invention disclose a polarized dilute blue scorpion venom solution, a method for making a polarized dilute scorpion venom solution, and a method for administering dilute scorpion venom solution. The polarized dilute scorpion venom solution relieves pain, improves immune-system response, treats cancer, prevents cancer, improves quality of sleep, reduces inflammation, and minimizes negative biological response to chemotherapy and radiation treatment.
Owner:IRREVOCABLE DE FIDECOMISON CONFIANZA GENERAL DE FAMILIAR IRREVOCABLE DE ARTHUR MIKAELIAN

Genetic engineering for recombining scorpion venom rBmKaIT1

A gene engineering for preparing the recombined scorpion venom rBmk alpha IT1 includes designing and chemically synthesizing the coded and recombined gene of said scorption venom rBmk alpha IT1, cloning it to plasmid, high expression in colibacillus, denaturing, renaturing, high efficiency liquid-phase chromatographic separation and purifying. Its advantage is high purity (more than 95%).
Owner:SHANGHAI CHEMPARTNER CO LTD

Scorpion venom protein polypeptide colon-targeted preparation and preparation method thereof

The invention discloses a scorpion venom protein polypeptide colon-targeted preparation and a preparation method thereof. Low-ester pectin is used as a main carrier and dripped into solution containing calcium ions, pellets are formed after reaction and solidification of the low-ester pectin, the pellets are soaked in polymine solution with a certain concentration and further cross-linked after being dried to form outer layers with higher hydrophobicity, and the scorpion venom protein polypeptide colon-targeted preparation is obtained after drying. After the preparation is taken orally, medicines are concentrated to release at the position of a colon, the concentration of the medicines at the position of the colon can be remarkably improved, the medicines directly contact with a focus of the colon and can be effectively prevented from being damaged by gastric acid or enzyme and the like in a stomach and a small intestine, and therapeutic effects of the medicines are made full use of.
Owner:FUJIAN HEALTH COLLEGE

Anti-wrinkle essence containing adipose-derived stem cell extract and preparation method of anti-wrinkle essence

The invention relates to the technical field of cosmetics and biological medicines, in particular to anti-wrinkle essence containing adipose-derived stem cell extract and a preparation method of the anti-wrinkle essence. The anti-wrinkle essence containing the adipose-derived stem cell extract is composed of the following components in parts by weight: 8 to 20 parts of an adipose-derived stem cellexosome suspension, 8 to 20 parts of an adipose-derived stem cell inclusion, 0.5 to 2 parts of mung bean peptide, 0.5 to 2 parts of tilapia mossambica polypeptide, 0.5 to 2 parts of scorpion venom polypeptide, 1 to 6 parts of glycerinum, 0.1 to 4 parts of ethylene glycol, 0.1 to 4 parts of xanthan gum, 0.1 to 4 parts of hyaluronic acid, 1 to 2 parts of phenoxyethanol, 0.03 to 0.05 part of ethylhexyl, 0.1 to 0.2 part of EDTA, 0.3 to 0.8 part of polysorbate, 1 to 2 parts of oxidized lecithin, 1 to 5 parts of tocopherol and 55.2 to 94.92 parts of distilled water. The anti-wrinkle essence provided by the invention contains the adipose-derived stem cell extract, and a utility evaluation experiment proves that the anti-wrinkle essence has a certain practical effect on skin wrinkle resistance. After the anti-wrinkle essence is used, the improvement conditions of skin elasticity and wrinkle depth of volunteers are superior to those of comparative examples and commercially available anti-wrinkle products, and the anti-wrinkle essence has an obvious synergistic anti-wrinkle effect.
Owner:辽宁盛京干细胞科技有限公司 +2

Human antibody variants that specifically recognize the toxin CN2 from Centruroides noxius scorpion venom

InactiveUS20070071750A1Sugar derivativesBacteriaCentruroides noxiusAntibody fragments
The present invention is directed to recombinant human antibodies specific for Cn2 toxin from C. noxius scorpion venom. The antibodies are able to recognize the toxin and preferably neutralize it as well as the whole venom of C. noxius scorpion. This invention is also directed to a human non-immune phage display library. One clone that specifically binds the Cn2 toxin was affinity matured by directed evolution. Three cycles of maturation were performed and several scFv clones were isolated which specifically recognize toxin Cn2 with increased Kd of 446 fold. All variants were monomeric and only variants 6009F, 6105F and 6103E showed to be capable of neutralizing toxin Cn2 and the whole venom. Variant 6009F recognizes a different epitope than that of BCF2, a murine monoclonal antibody raised against scorpion toxin Cn2 which is also capable of neutralizing both Cn2 toxin and the whole venom when tested in mice, as well as that of commercially available polyclonal antibody fragments antivenom from horse. The scFv 6009F is the first reported recombinant human antibody fragment capable of neutralizing a scorpion venom. These results pave the way for the generation of safer autologous recombinant neutralizing antivenom against scorpion stings. The antibodies of the present invention can be used as part of a composition to treat those in need of treatment including those already stung by one or more scorpions, particularly C. noxius scorpions.
Owner:UNIV NAT AUTONOMA DE MEXICO

Peptide nutrient liquid

The present invention relates to a polypeoptide nutrient liquor and its preparation method. Said method includes the following steps: (1), extracting scorpion venom fluid, freeze-drying to obtain freeze-dried scorpion venom powder; (2), adding distilled water to dilute the freeze-dried scorpion venom powder, high-speed centrifugalization to extract scorpion venom polypeptide, freeze-drying to obtain scorpion venom polypeptide dried powder; and (3), making the scorpion venom polypeptide into oral solution or nutrient liquor for raising immunity of human body, reducing blood-lipid and reducing blood pressure.
Owner:黄巨轮

Prepn of Scorpion venom polypeptide

The present invention relates to a biological medicine preparing method, especially, preparation process of scorpion venom polypeptide. The preparation process includes charging column balancing, elution, charging sample, gradient elution, inspection, packing and other steps. The process produces colorless or yellowish liquid scorpion venom polypeptide, which may be used in producing scorpion venom polypeptide freeze drying powder with wide application in medical field.
Owner:赵恩成 +1

Scorpion venom heat-resistant synthetic peptide and application thereof

The invention belongs to the field of research and development of polypeptide medicines and discloses a scorpion venom heat-resistant synthetic peptide and application thereof. An amino acid sequence of an SVHRP (scorpion venom heat-resistant peptide) is detected out from BmK (Buthus martensii Karsch) which is a traditional Chinese medicine; according to animal experiment verification, a scorpion venom heat-resistant peptide extract liquid sample has pharmacological activity in prevention and treatment of intractable epilepsy, Parkinson's disease and Alzheimer's disease, the sample is subjected to LaGm composite and repeated fast magnetic separation prior to nanoLC-ESI-MS (nano-liter reversed-phase chromatography and electrospray ionization mass spectrometry) integrated mass spectrometry parallel experiment to detect out a polypeptide sequence formed by 15 amino acid residues. The scorpion venom heat-resistant synthetic peptide is prepared by solid-phase chemical synthesis, chromatography purification and mass spectrometry identification. An amino acid sequence of the scorpion venom heat-resistant synthetic peptide is as shown in SEQ ID NO.1 and keeps pharmacological activity and safety of the scorpion venom heat-resistant peptide, and the scorpion venom heat-resistant peptide also has a characteristic of biological activity in promotion of reverse differentiation of neuroglial cells into neural stem cells.
Owner:上海万锦医药科技有限公司

Scorpion venom extractor

The invention relates to a scorpion venom extractor, which comprises a base, a funnel collector, an ice box, an inner electroconductive net, an outer electroconductive net, a glass tube and a vibrator. The vibration of the vibrator in the glass tube and the smell of insect food in the glass tube are utilized to allure a scorpion, so that the scorpion can spontaneously extend the tail into the cell of the outer electroconductive net to touch the inner electroconductive net and thereby can be electrically shocked to discharge scorpion venom, and thereby the purpose of venom extraction is achieved.
Owner:徐建明

Extracting purification of scorpion venom

A process for extracting the scorpion venom and cleaning it includes such steps as cleaning the living scorpion, stimulating it at a temp higher than 30 deg.C in aseptic environment by electric pulses (8-10 v) at 139 Hz for a time less than 1 s, collecting scorpion venom by a container at -2-2 deg.C, filtering and freeze-drying. Its advantages are high quality and content of toxic protein, and low damage to scorpion.
Owner:张学义

Human antibodies that specifically recognize the toxin Cn2 from Centruroides noxius scorpion venom

InactiveUS7381802B2Sugar derivativesBacteriaCentruroides noxiusAntibody fragments
The present invention is directed to recombinant human antibodies specific for Cn2 toxin from C. noxius scorpion venom. The antibodies are able to recognize the toxin and preferably neutralize it as well as the whole venom of C. noxius scorpion. This invention is also directed to a human non-immune phage display library. One clone that specifically binds the Cn2 toxin was affinity matured by directed evolution. Three cycles of maturation were performed and several scFv clones were isolated which specifically recognize toxin Cn2 with increased Kd of 446 fold. All variants were monomeric and only variants 6009F, 6105F and 6103E showed to be capable of neutralizing toxin Cn2 and the whole venom. Variant 6009F recognizes a different epitope than that of BCF2, a murine monoclonal antibody raised against scorpion toxin Cn2 which is also capable of neutralizing both Cn2 toxin and the whole venom when tested in mice, as well as that of commercially available polyclonal antibody fragments antivenom from horse. The scFv 6009F is the first reported recombinant human antibody fragment capable of neutralizing a scorpion venom. These results pave the way for the generation of safer autologous recombinant neutralizing antivenom against scorpion stings. The antibodies of the present invention can be used as part of a composition to treat those in need of treatment including those already stung by one or more scorpions, particularly C. noxius scorpions.
Owner:UNIV NAT AUTONOMA DE MEXICO

Antimicrobial peptide derived from scorpion venom as well as preparation method and application of antimicrobial peptide

The invention provides an antimicrobial peptide derived from scorpion venom as well as a preparation method and application of the antimicrobial peptide. The antimicrobial peptide RLL has a sequence shown as SEQ ID No.1. A peptide RSN is obtained by intercepting 14 amino acids in the middle of the scorpion toxin, negatively charged aspartic acid in the peptide RSN is replaced with positively charged arginine, and serine, glycine and asparagine in a peptide chain are replaced with leucine to obtain the antimicrobial peptide RLL; and the antimicrobial peptide RLL has very low hemolytic activityand eukaryotic cytotoxicity, the antimicrobial peptide cannot cause 10% erythrocyte hemolysis at a concentration of 128 [mu]mol / L, the survival rate of mouse macrophages RAW 264.7 reaches 80% or more,and the antimicrobial peptide has the development potential of becoming an antibiotic substitute.
Owner:NORTHEAST AGRICULTURAL UNIVERSITY

Method for processing scorpion

The invention relates to a method for processing Chinese medicinal materials, particularly to a method for processing scorpions. The prior method for processing the scorpions is carried out by boiling, thereby inducing the live scorpions to secrete scorpion venom to the exterior after suffering from heat flash stimulation, and the scorpion venom is thermolabile and soluble in water, so as to lose a large amount of effective ingredients at the beginning of the processing. The invention provides a novel method for processing the scorpions, which comprises the following steps of soaking a live scorpion in clean water so as to cause the scorpion to discharge food and residues in digestive tract out of the body under a comfortable environment, and killing scorpion by refrigerating at low temperature so as not to loss effective ingredients in the scorpion. The method can maximally retain the effective ingredients of the scorpion. The obtained scorpion by the method has the peptide and protein extraction amount of 1.6-2.0g / 3g scorpion, and extraction rate of 53.3-66.6%, which is increased by a factor of two compared with the prior process. The inventive processing method has the advantages of improved therapeutic effect of scorpion, reduced consumption of raw materials, and increased benefit.
Owner:SHANDONG UNIV OF TRADITIONAL CHINESE MEDICINE

Preparation and use method of antibody resisting scorpion venom of buthus martensii karsch in China F (ab') 2

The invention relates to a preparation and use method of an antibody resisting scorpion venom of buthus martensii karsch (BMK) in China F (ab') 2. The antibody enables mouse survival rate to reach 100% when ratio of the antibody to scorpion venom of BMK in Shanxi is 2: 1 (M: M), enables mouse survival rate to reach 100% when the ratio of the antibody to scorpion venom of BMK in Liaoning is 0.5: 1 (M: M), and also enables the mouse survival rate to reach 100% when the ratio of the antibody to scorpion venom of BMK in Shandong and Henan is 1: 1 (M: M); and the immunodiffusion detection result shows that a clear immunoprecipitation line appears when the mass ratio of the antibody to scorpion venom of BMK from various regions reaches 0.4: 1. According to the preparation method, a horse is immunized with scorpion venom of buthus martensii kirsch to gain immunized blood plasma, and the immunized blood plasma is subjected to salting out for preparing IgG (Intravenous Gamma Globulin), enzymolysis and purification by an ion exchange column, so as to obtain a high-purity F (ab') 2 active fragment.
Owner:中国人民解放军成都军区疾病预防控制中心

Full scorpion obstruction removing wine and its preparing process

The obstruction removing full scorpion wine is produced with rice, distillerí»s yeast, scorpion venom, Chinese flowering quince, astragalus root, cassia twig, teasel root, largeleaf gentian root and other ten kinds of Chinese medicinal materials in certain weight proportion, and through mixing, adding water, sealed fermentation for 50 days, distillation in stainless steel container at 120-160 deg C to obtain distillate, and adding proper amount of honey sugar homogeneously to obtain the obstruction removing full scorpion wine. The fermentation process makes the obstruction removing full scorpion wine possess the effects of the medicines, and drinking the wine regularly can raise bodyí»s immunity, strengthen physique and resist cancer.
Owner:雷明波

Scorpion electric venom collecting device and method

The present invention discloses a buthus martensi karsch electronic scorpion venom collector and a process for collecting scorpion venom. The scorpion venom collector comprises an adjustable power-supply apparatus, clamps for collecting scorpion venom, a switch for collecting scorpion venom and a conducting wire, wherein, both the clamps for collecting scorpion venom and the switch for collecting scorpion venom are in clamp shape suitable for holding in hand, the switch for collecting scorpion venom is in series connection between the electrode of the clamps for collecting scorpion venom and the output terminal of the adjustable electric source. The buthus martensi karsch electronic scorpion venom collector in accordance with the present invention collects scorpion venom through electric shock at appropriate environment temperature and reasonable electric voltage and frequency, is capable of improving economic effectiveness in scorpion cultivation and is suitable for the scorpion aquaculture because of high operating efficiency for collecting scorpion venom and large scorpion venom yield.
Owner:LUSHAN JUXIN SCORPION DEV

Preparation method of natural scorpion venom polypeptide and application of natural scorpion venom polypeptide to bone marrow haematopoietic functional protection

InactiveCN104725498AProven new medicinal usesPeptide/protein ingredientsPeptide preparation methodsTotal amino acidsButhus
The invention discloses a natural scorpion venom polypeptide. The natural scorpion venom polypeptide is a novel protein separated from scorpion venom of Buthus martensii Karsch and has a novel medicinal purpose on the aspect of bone marrow haematopoietic functional protection. A preparation method of the natural scorpion venom polypeptide comprises the following steps of (1) collecting the scorpion venom of Buthus martensii Karsch; (2) separating SVPIV; (3) purifying BmKpp; (4) measuring the molecular weight and amino acid sequence of of BmKpp; and (5) measuring the bone marrow haematopoietic functional protection effect of BmKpp. BmKpp is a novel polypeptide from scorpion venom of Buthus martensii Karsch and has a remarkable bone marrow haematopoietic functional protection effect. BmKpp is single in component, precise in molecular weight, clear in total amino acid sequence, remarkable in cell proliferation promoting effect as well as standard and controllable in quality in the purification process so as to be beneficial to large-scale production. BmKpp has remarkable advantages and prospects on the aspects of bone marrow haematopoietic functional protection and development of drugs for preventing / protecting cell stress injury (radiotherapy, chemotherapy and the like).
Owner:孔天翰 +2

Aging-resisting and wrinkle-removing composition as well as preparation method and application thereof

The invention belongs to the field of cosmetics, and particularly relates to a composition with functions of improving skin conditions, removing wrinkles and resisting aging as well as a preparation method and application of the composition. The composition comprises the following main components of 0.01 %-1 % of snake venom-like peptide, 0.01 %-1 % of bee venom peptide, 0.01 %-1 % of scorpion venom peptide, 0.01 %-1 % of conotoxin and 0.01 %-1 % of aurelia aurita extract; and the composition can also comprise 0.01 %-1.0 % of anti-free radical component. The preparation process of the composition is simple and feasible, and the finished product can be used as mask liquid and the like to be directly applied to the skin surface, and can also be used as a production material to be used for manufacturing other skin care products; and the composition simultaneously has the effects of instantly removing wrinkles and resisting aging for a long time, simplifies the care process of people who need to remove wrinkles and resist aging, also has the functions of moisturizing, increasing skin elasticity, brightening skin color and the like, and comprehensively improves the skin conditions.
Owner:铭颜生物科技(广州)有限公司 +1

Traditional Chinese medicine for mainly treating trauma as well as sore and ulcer, preparation method and application of traditional Chinese medicine

ActiveCN103263451AStop bleeding and relieve painQuickly reduce inflammation and swellingAnthropod material medical ingredientsHydroxy compound active ingredientsWaxCurative effect
The invention belongs to the technical field of medicines, in particular relates to a traditional Chinese medicine for mainly treating trauma as well as sore and ulcer with quick working speed, high recovery rate and obvious treatment effect and a preparation method of the traditional Chinese medicine, and also discloses an application of the traditional Chinese medicine in a process of preparing the medicine for treating the trauma as well as sore and ulcer. The traditional Chinese medicine for mainly treating the trauma as well as sore and ulcer is prepared from the following medical materials in parts by weight: 50-70 parts of scorpio or 0.3-1 part of scorpion venom, 45-65 parts of cantharides or 0.06-0.2 part of cantharidin, 25-60 parts of borneol, 25-60 parts of bee wax and 1000 parts of sesame oil. The traditional Chinese medicine is reasonable in prescription and convenient to use, has an obvious treatment effect and high recovery rate when being used for treating the trauma as well as sore and ulcer, does not leave a scar after being used for treating, and has broad market prospects.
Owner:高原

Scorpion venom polypeptide for promoting cell proliferation and preparation method and medicinal application thereof

The invention relates to a scorpion venom polypeptide for promoting cell proliferation and a preparation method and medicinal application thereof. The scorpion venom polypeptide for promoting cell proliferation is characterized by being separated from the scorpion venom of Buthus martensii Karsch and then purified, 66 amino acid residues at the N end of the scorpion venom polypeptide for promoting cell proliferation are of a sequence shown in SEQ ID No. 1 in a sequence table and have molecular weight of 7217.4Da. The new polypeptide which is from the scorpion venom of Buthus martensii Karsch has a function of promoting the proliferation of hematopoietic cells and has the characteristics of single component, accurate molecular weight, clear 66 amino acid residues at the N end, obvious effect of promoting cell proliferation, controllable quality standard of the purification process; therefore the scorpion venom polypeptide for promoting cell proliferation is favorable to large-scale production. The scorpion venom polypeptide for promoting cell proliferation has significant advantages and wide application prospect in the aspect of development of medicines for promoting cell proliferation and preventing cell stress induced injury, radiation and the like and is capable of promoting the formation of the marrow hematopoietic cell colonies of mice subjected to Gamma-ray or X-ray irradiation and the proliferation of M-NFS-60 cells.
Owner:广州医学院

Polarized scorpion venom solution and a method for making polarized scorpion venom solution

Various embodiments of this invention disclose a polarized dilute blue scorpion venom solution, a method for making a polarized dilute scorpion venom solution, and a method for administering dilute scorpion venom solution. The polarized dilute scorpion venom solution relieves pain, improves immune-system response, treats cancer, prevents cancer, improves quality of sleep, reduces inflammation, and minimizes negative biological response to chemotherapy and radiation treatment.
Owner:IRREVOCABLE DE FIDECOMISON CONFIANZA GENERAL DE FAMILIAR IRREVOCABLE DE ARTHUR MIKAELIAN

Extraction method for scorpion venom

The invention relates to an extraction method for scorpion venom. The method comprises the steps of dedusting, collection of venom, centrifugation and freeze drying. The scorpion venom prepared in the invention has a high purity and non-damaged activity.
Owner:马震

Traditional Chinese medicine composition for treating chronic suppurative otitis media and preparation method thereof

The invention relates to a traditional Chinese medicine composition for treating chronic suppurative otitis media and a preparation method thereof. The traditional Chinese medicine composition contains the following components: scorpions or scorpion venom powder, pseudo-ginseng, borneol, musk, lightyellow sophora roots and dried alum. Experimental results show that the composition can be used for treating chronic suppurative otitis media, has efficiency of 100 percent and a cure rate of not lower than 85 percent, and has effects better than those of the prior art.
Owner:XINXIANG MEDICAL UNIV
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More