702 results about "Esophagus Cancers" patented technology

The invention relates to a Chinese medicinal preparation for treating cancer, and the Chinese medicinal preparation is prepared from 110 raw material drugs, such as yew, barbed skullcap herb, hairyvein agrimony and laggera pterodonta. The preparation can be oral solution, granules, powder, capsules, electuary and tablets. 110 Chinese medicaments are adopted, and monarch, minister, assistant and guide drugs are reasonably compatible and are comprehensively taken to play the effect of treating both principal and secondary aspect of cancers. The raw material drugs adopted in the Chinese medicinal preparation are common Chinese medicaments, and are low in manufacture cost and small in side effect. The medicament has the advantages of capabilities of effectively strengthening the body immunity and attacking pathogen without hurting a body along with quick response, high curative rate, high heal rate, low relapse rate, treatment of both principal and secondary aspect of cancers, safety and reliability, and can be used for treating various types of cancers, especially lung cancer, gastric cancer, liver cancer, esophagus cancer, pancreatic cancer, cervical cancer and breast cancer.

The invention belongs to the field of molecular biology, and particularly relates to a method for CRISPR / Cas9 targeted knockout of a human ezrin gene enhancer key region and specific gRNA thereof. In the method, according to the design principle of CRISPR / Cas9, two target sites are designed at the upstream and the downstream of the human ezrin gene enhancer key region, corresponding oligonucleotide sequences are synthesized and then connected to a carrier pX459 to construct recombinant plasmids, the recombinant plasmids are transfected with a human esophagus cancer cell line, and then specific knockout of the human ezrin gene enhancer key region can be achieved. The method and the specific gRNA have great significance for study on clinical tumor therapy with the human ezrin gene enhancer as the target.

The invention provides novel compositions, methods and uses, for the diagnosis, prognosis, prediction, prevention and aid in treatment of malignant neoplasia such as breast cancer, ovarian cancer, gastric cancer, colon cancer, esophageal cancer, mesenchymal cancer, bladder cancer or non-small cell lung cancer. Genes that are chromosomally amplified in breast tissue of breast cancer patients are disclosed. Further disclosed are chromosomally amplified genes and non-amplified genes that correlate to Taxane resistance, Taxane benefit or adverse Taxane reaction, which can be used as an aid to make therapy dicisions.

The invention provides brefeldin A ester derivatives having antitumor activity and their preparation method and use. The brefeldin A ester derivatives have structures shown in the structural general formula (I). The brefeldin A ester derivatives have high effects on esophagus cancer, lung cancer, kidney cancer, colorectal cancer and prostatic cancer and have an in-vitro detection effective inhibition rate of 80%. The preparation method of the brefeldin A ester derivatives has simple processes and can be operated easily.

The invention relates to the field of culture of tumor organoids, and in particular relates to a special medium used for in-vitro culture of esophagus cancer tumor organoid based on human esophagus cancer tissue and a culture method. The special medium comprises a receptor tyrosine kinase ligand, an Rho-associated coiled-coil protein kinase inhibitor, vitamin and hormone, an antioxidant, and an agonist for inhibiting cell differentiation pathway. According to the method, through the step-by-step culture technology adopting conditional dedifferentiation, tumor cells rapidly amplify within a short time to form the organoid. Through the step-by-step culture technology, primary cells rapidly form the organoid, meanwhile, adequate cells are formed within the effective time, so that the follow-up experiment operation can be conveniently carried out, and therefore, the culture speed and success rate of the organoid are improved.

The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.

The present invention relates to American goldenrod herb total flavone extract and its preparation process and use. The American goldenrod herb total flavone extract contains quercetin, quercetin-3-O-beta-D-heteroside, kaempferol-3-O-alpha-L-rhamnoside, chlorogenic acid, etc. capable of preventing and treating senile dementia, various inflammatory respiratory diseases, esophagus cancer, etc. The preparation process is simple, high extracting rate, and the extract has high pharmacological effect, stable property, low toxicity and controllable quality.

The invention discloses a cancer pain-relieving plaster prepared by a preparation A and a preparation B, wherein the preparation A is prepared by five branches, five skins, one brick, one stone, five cores, and the like; the preparation B is prepared by poria cocos, pinellia ternate, jackinthepulpit tuber rhizome, trichosanthes kirilowii maxim, centipede, zaocys dhumnade, and the like. When the cancer pain-relieving plaster is prepared, the preparation B is added into the preparation A to be decocted for 4.5-5.5 hours, red lead is added to be mixed to pasty fluid, then cold water is added for steeping to releasing fire-toxin, water is changed once one day, and the plaster is obtained after steeping for 7 days. When the plaster is used, the plaster is coated on cotton cloth or plaster paster. The cancer pain-relieving plaster mainly aims at tumour cancers of lung cancer, gastric cancer, liver cancer, pancreatic cancer, colon caner, rectal caner, kidney cancer, bladder caner, breast cancer, cervical cancer, ovarian cancer, esophagus cancer, laryngeal cancer, and the like and is obvious in pain-relieving effect.

The invention discloses a traditional Chinese patent medicine with the components of plant polysaccharide and bamboo extract for treating medium and terminal cancer, which has a formula as follow: 10 kg of whangee, 5 kg of CV.Ventricousinternode, 10 kg of moso bamboo, 5 kg of palm bamboo, 5 kg of phyllostachys glauca, 10 kg of fishscale bamboo and 5 kg of fortune paulownia bark. A method for preparing the traditional Chinese patent medicine comprises the following steps: adding 50 kg of water into the total 50 kg of the medical materials; decocting the mixture to obtain 200 ml to 400ml of concentrated material; adding mineral trace elements: 0.01 milligrams of calcium, 0.01 milligrams of ferrum, 0.01 milligrams of zinc, 0.01 milligrams of selenium, 0.01 milligrams of iodine and 0.01 milligrams of potassium which are essential to the body into the concentrated material after removing impurities and filtering; finally, fermenting the final mixture to obtain the medicine, and bottling the medicine for use. The traditional Chinese patent medicine has the beneficial effects of treating medium and terminal esophagus cancer, gastric cancer, intestinal cancer, liver cancer, cerebral cancer and other cancers and treating gastritis, gastric ulcer, hepatitis, rhinitis and other inflammation. In addition, the traditional Chinese patent medicine can be also used for treating skin cancer and various kinds of skin diseases by exterior spreading. The traditional Chinese patent medicine takes effect rapidly and has no toxic and side effect.

Described herein are platinum-based brush-arm star polymers (Pt-BASPs), or a pharmaceutical composition thereof, for delivery of platinum-based agents, such as cisplatin. Also provided are methods and kits involving the Pt-BASPs, or a pharmaceutical composition thereof, for treating proliferative diseases such as cancers (e.g., lung cancer, head-and-neck cancer, esophagus cancer, stomach cancer, breast cancer, pancreas cancer, liver cancer, kidney cancer, or prostate cancer) in a subject.

The invention discloses a diagnosis marker suitable for an early-stage esophageal squamous cell cancer diagnosis and a screening method of the diagnosis marker. Twenty five kinds of serum metabolic markers and ten relevant metabolic pathways are discovered; through the combination of the twenty five kinds of serum metabolic markers, the diagnosis marker used for an esophagus cancer diagnosis can be obtained. The screening method of the diagnosis marker has high operability; the diagnosis marker can be used for building a diagnosis model; the diagnosis model has the advantages of good effect, high sensitivity and good specificity, is suitable for a late-stage esophagus cancer diagnosis and is also suitable for the early-stage esophagus cancer diagnosis. The diagnosis model built by adopting the diagnosis marker provided by the invention has the advantages that the diagnosis can be realized only through blood sampling; the noninvasive effect is achieved; the cost is low; the modern internal invasive diagnosis mode can be well replaced; the pain of a patient is greatly reduced; in addition, the diagnosis speed is high; convenience is realized; the required time is short; the work efficiency is improved; the early discovery and early treatment of an esophagus cancer can be favorably realized; good clinic use and popularization value is realized.

The invention discloses a segmentation method for esophagus cancer in chest CT images. According to the method, first, multiple groups of CT images containing the esophagus cancer are selected, and the CT images containing the esophagus cancer are used as training samples; the selected CT images are preprocessed, esophagus cancer features are acquired, and the images obtained after feature description is performed are used as training data; an esophagus cancer semantic segmentation model based on a full-convolution neural network is established, described esophagus cancer features are used asfeature input of the full-convolution neural network to serve as learning samples for training, and an esophagus cancer segmentation network model is obtained; three-dimensional reconstruction is performed on the esophagus cancer, wherein three-dimensional reconstruction and analysis are performed on an esophagus cancer segmentation result obtained through the obtained esophagus cancer segmentation network model, and esophagus cancer image omics parameters under a three-dimensional space are obtained; and the obtained esophagus cancer image omics parameters are visually displayed. The method is small in model scale, high in speed and high in accuracy.

The invention relates to the field of organic synthesis and medicine, and discloses a preparation method for N-substituted methyl-3,5-disubstituted benzylidene base-4-piperidone and biological activity for efficiently inhibiting cell line proliferation such as leukemia, ovarian cancer, breast cancer, liver cancer and esophagus cancer. The method includes: starting from various substituted methylamine and methyl acrylate, sequentially going through Michael addition, Dieckmann condensation, acidolysis and decarboxylation to obtain N-substituted methyl-4-piperidone, and subjecting the N-substituted methyl-4-piperidone to aldol reaction with substituted benzaldehyde to obtain a target compound N-substituted methyl-3,5-disubstituted benzylidene base-4-piperidone. The target compound can selectively and efficiently inhibit cell line proliferation such as leukemia, ovarian cancer, breast cancer, liver cancer and esophagus cancer, and activity of inhibiting carcinoma cell line proliferation is obviously higher than conventional chemotherapeutic 5-fluorouracil.

A Chinese medicine in the form of decoction for treating esophagus cancer, stomach cancer, lung cancer and breast cancer is prepared from 9 Chinese-medicinal materials including astragalus root, pseudostellaria root, tortoise plastron, leach, etc through decocting.

The invention provides a biomarker compound for early diagnosing esophagus cancer and specifically provides a characteristic polypeptide compound capable of passing mass spectrum detection. The compound comprises three polypeptides at the mass-to-charge ratio of 1925.5m / z, 2950.6m / z and 5900.0m / z. When the 2950.6m / z and 5900.0m / z polypeptides are subjected to up-regulation expression and 1925.5m / z polypeptide is subjected to down-regulation expression, the subject is confirmed as an esophagus cancer patient or a potential esophagus cancer patient. The biomarker provided by the invention can be used for early diagnosing and screening the esophagus cancer; the method is simple, easy in operation and high in accuracy; a new method and thought for early diagnosing and screening the esophagus cancer are supplied; and meanwhile, the invention also discovers that thrombin sensitive protein 1 (TSP1) can be singly taken as a biomarker used for diagnosing the esophagus cancer or forecasting the prognosis of the esophagus cancer in serum or tissue.

The invention discloses a water-soluble fullerene nano-material as well as a preparation method and an application thereof. A general structural formula of the water-soluble fullerene nano-material is shown as C2n(OH)x(Amino Acid)y, wherein n is less than or equal to 60 and is greater than or equal to 20, x is less than or equal to 50 and is greater than or equal to 0, y is less than or equal to 20 and is greater than or equal to 0 and Amino Acid is water-soluble amino acid. The nano-material provided by the invention is applied to preparation of medicines for treating tumors, wherein the tumors include at least one of liver cancer, lung cancer, colorectal cancer, renal cancer, pancreatic cancer, cancer in bones, breast cancer, ovarian cancer, prostatic cancer, esophagus cancer, gastric cancer, oral cancer, nose cancer, laryngeal cancer, cancer of biliary duct, cervical cancer, uterine cancer, testicle cancer, meningeoma, skin cancer, melanoma and sarcoma. The nano-material profvided by the invention is good in water solubility, good in affinity with organisms and low in preparation cost, and the nano-material can obviously block off tumor vessels and rapidly cut off nutrition supply to tumor tissues.

An application of the scutellaria extract in preparing the medicine for esophagus cancer is disclosed, and it features that scutellarin, scutellaroside, or their mixture can be used to prepare the pharmacologically receptable sale for suppressing the splitting of cancer cell, inducing the withering of cancer cell and inhibiting the generation of the blood vessel inside esophagus cancer.

The present invention is solid tumor treating medicine composition and belongs to the field of medicine technology. The medicine composition contains melphalan in effective anticancer amount and medicinal supplementary material. The medicinal supplementary material is mainly biocompatible, degradable and absorbable polymer, and during the degradation and absorption of the polymer, melphalan is released slowly to local tumor part to lower the systemic toxic reaction and to maintain local medicine concentration. The present invention has enhanced treating effect. The solid tumor includes cerebral tumor, liver cancer, lung cancer, esophagus cancer, gastric cancer, etc.

The invention relates to L-alanine-(14-oridonin) ester trifluoroacetate as well as a preparation method and application thereof. The preparation method of the compound comprises the following steps of: by taking oridonin (II) as a starting material, generating 14-position esterification reaction with N-BOC-L-alanine in the presence of DCC to obtain N-BOC-L-alanine oridonin ester (III), removing a BOC protective group in trifluoroacetic acid, and salt-forming to obtain L-alanine-(14-oridonin) ester trifluoroacetate (I). The compound can be applied to clinic very well, and is used for treating esophagus cancer, gastric cancer, primary liver cancer, pancreatic cancer, cardia cancer, colorectal cancer, bladder cancer, breast cancer, acute myelogenous leukemia, and the like.

The invention belongs to the field of prognosis estimation and canceration risk prediction on clinic of molecular biology, and particularly relates to application of a molecule of a detection ANO1 protein in the preparation of a kit or a detection agent for the prognosis estimation and precancerous disease progression risk prediction of esophageal squamous carcinoma. The molecule expressed by the detection ANO1 protein can be a nucleic acid, a protein or a compound, thus showing that the ANO1 protein can be used as a molecular marker for the prognosis estimation and precancerous disease progression risk prediction of the esophageal squamous carcinoma.

Described herein are platinum-based brush-arm star polymers (Pt-BASPs), or a pharmaceutical composition thereof, for delivery of platinum-based agents, such as oxaliplatin. Also provided are methods and kits involving the Pt-BASPs, or a pharmaceutical composition thereof, for treating proliferative diseases such as cancers (e.g., lung cancer, head-and-neck cancer, esophagus cancer, stomach cancer, breast cancer, pancreas cancer, colorectal cancer, liver cancer, kidney cancer, or prostate cancer) in a subject.

Compositions and methods are disclosed for treating, preventing and / or ameliorating the symptoms of cancers such as breast cancer, colon cancer, ovarian cancer, lung cancer, leukemia, skin cancer, prostate cancer, throat cancer, esophageal cancer etc., where the composition includes an associated complex of a nonsteroidal, anti-inflammatory drug (NSAID) and a phospholipid and the method includes administering before or after cancer identification an anti-cancer amount of the compositions.

Peptide vaccines against cancer are described herein. In particular, the present invention describes epitope peptides derived from MYBL2 that elicit CTLs. The present invention also provides established CTLs that specifically recognize HLA-A24 positive target cells pulsed with the peptides. Antigen-presenting cells and exosomes that present any of the peptides, as well as methods for inducing antigen-presenting cells are also provided. The present invention further provides pharmaceutical agents containing the MYBL2 polypeptides or polynucleotides encoding thereof, as well as exosomes and antigen-presenting cells as active ingredients. Furthermore, the present invention provides methods for treating and / or prophylaxis of (i.e., preventing) cancers (tumors), and / or prevention of postoperative recurrence thereof, as well as methods for inducing CTLs, methods for inducing anti-tumor immunity, using the MYBL2 polypeptides, polynucleotides encoding the polypeptides, exosomes or antigen-presenting cells presenting the polypeptides, or the pharmaceutical agents of the present invention. The cancers to be targeted include, but are not limited to, testicular tumor, pancreatic cancer, bladder cancer, non-small cell lung cancer, small cell lung cancer and esophageal cancer.

The invention relates to an application of a tanshinone compound in preparing anti-tumor medicaments, and the prepared medicaments can resist tumors, such as brain tumors, lung cancer, liver caner, breast cancer, prostatic cancer, pancreatic cancer, cervical cancer, gastric cancer, esophagus cancer, and the like. Proved by experiments, the tanshinone compound is concentration-dependent to suppress the proliferation of tumor cells. The compound can obviously induce the expression of quinone reductase and obviously suppress the generation of tumor vessels, thus the compound can also be used for preparing cancer chemical prevention medicaments, anti-inflammatory medicaments and medicaments for suppressing the generation of the tumor vessels. Frequently used low-price reagents, such as alcohol, chloroform, methanol, silica gel, and the like, are used for separating tanshinone compound monomers from medicinal materials. The method is simple and reliable, has low cost and high efficiency, can be used for carrying out industrialized mass production and is beneficial to popularization and application. The tanshinone compound has a structural general formula disclosed in the specification.

The invention discloses a detection method in the technical field of biological engineering and relates to a method for employing double indicatrix immunochromatography by semi-quantity to diagnose carcinoembryonic antigen in particular. The carcinoembryonic antigen is a broad-spectrum tumor marker, can reflect the existences of multi-tumors to people and is a better tumor marker for curative effect judgment, disease development, monitoring and preoperative prognosis on colorectal cancer, breast cancer and lung cancer. Clinic detection on CEA (carcinoembryonic antigen) is usually served as a detection criterion for the early aided diagnosis and cancer postoperation recrudescence of colon cancer, gastric cancer, esophagus cancer, rectal cancer, etc. At present, common CEA detection methods on clinic detection comprise ELISA (enzyme-linked immuno sorbent assay), CLIA and so on, waste time and labor, is not beneficial to popularization and has high cost. The technology of immune collaurum develops rapidly and is applied widely to the detection on infectious diseases, early pregnancy, cancer and the like. The method adopts the collaurum immune chromatography to build a method for quickly detecting the CEA, and can detect the range of a CEA gray area from 5ng / mL-20ng / mL with semi quantity. The CEA can be taken as the basis for differential diagnosis of benign and malignant tumors.

The invention provides a Chinese drug for curing the oesophagus cancer, which comprises a Chinese drug A and a Chinese drug B. The Chinese drug A adopts a hard honeyed pill which is prepared by bornel, cow bezoar, arenobufagin, agalloch, musk, saliter, sal ammoniac, pearl, chlorite schist, asafetida and notoginseng according to a certain proportion by weight, and the Chinese drug B adopts soft honeyed pill which is prepared by Chinese angelica root, root of herbaceous peony, safflower, rhizoma chiuanxiong, burred tuber, zedoary, pinellia, aucklandia root, amomum fruit, corydalis tuber, bitter orange, cuttlebone, barbed stullcap, oldenlandia, arrowhead, aloe, ginseng, atractylodes macrocephala, dried rehmannia root and licorice root according to a certain proportion by weight, and the Chinese drug A and B are separately packed and used together. The Chinese drug for curing the oesophagus cancer has good effects on curing middle-advanced oesophagus cancer, curing hiccought, relieving obstruction and restraining and killing cancer cells.

The invention relates to an anti-tumor medicine, which is prepared by Chinese medicine raw materials. The composition and the weight ratio of the Chinese medicine raw materials are codonopsis pilosula 30-100 parts, fructus ligustri lucidi 20-40 parts, orange peel 20-40 parts, chrysanthemum 30-50 parts, paris polyphylla 10-20 parts, dandelion 20-30 parts, patrinia 15-25 parts, snakeskin 15-25 parts, schizonepeta 30-45 parts, red flowers 15-25 parts, potentilla discolor 3-11 parts and fructus forsythiae 0.2-0.8 part. The anti-tumor medicine has a comprehensive formula, brings out the best in each other, strengthens the body resistance, cultures the basis, repairs tissue cells and enables the cells to be regenerated, reverses disease cells to be normal, can effectively treat malignant tumor including long cancer, esophagus cancer, intestinal cancer, bladder cancer, breast cancer, ovarian cancer, lymph cancer, uterine cancer and the like. The Chinese medicine is convenient to manufacture and use, safe, has no side and toxic effect, and is an ideal anti-tumor medicine.

The invention relates to a dry powder inhaler with a constituent rubescensin A as well as a preparation method and application thereof. The dry powder inhaler is a medicinal composition formed by mixing the constituent rubescensin A as an active constituent with pharmaceutically acceptable excipients. Compared with orally administrated medicines, the dry powder inhaler developed by using the technical scheme provided by the invention greatly improves the effect of the constituent rubescensin A on treating esophagus cancers, lung tumors and leukemia.