125 results about "Immunomodulatory drug" patented technology

The invention relates to combinations comprising an HDAC inhibitor and an immunomodulatory drug for the treatment of lymphoma in a subject in need thereof. Also provided herein are methods for treating lymphoma in a subject in need thereof comprising administering to the subject an effective amount of one of the above combinations.

The invention discloses a new class of propylene glycol derivatives represented by the general formula (I), a preparation method thereof, a pharmaceutical composition containing them, and their use as medicines, especially immunomodulatory medicines. This kind of compound with excellent curative effect and low toxicity can be used for immune disorder and immunosuppression; and can be used for treatment and / or low immunity, rejection after organ transplantation and autoimmune disease. General formula (I)

The invention discloses a spleen polypeptide extract extracted from the spleen tissue of mammals other than humans. The mammalian tissue is subjected to fat removal, homogenization, acid adjustment, freezing and thawing, pH adjustment, precipitation, heating, and centrifugation. Filtration, ultrafiltration and other steps to obtain the spleen polypeptide extract; the drug is an immunomodulatory drug that can improve and improve the immune function of the body, and can be used for primary and secondary cellular immune deficiency diseases (such as eczema, thrombocytopenia, multiple Infection syndrome, etc.), respiratory tract and lung infection, habitual cold, chronic hepatitis B, mumps, recurrent aphtha and other diseases, can be used in the treatment of leukopenia, leukemia, aplastic anemia caused by radiotherapy and chemotherapy , Lymphoma and other malignant tumors, to improve the malignant transformation of tumor patients, to improve postoperative or critically ill patients when they are weak.

Described herein are combination therapies for cancer (such as lymphoid malignancies) and immune diseases (such as autoimmune diseases and inflammatory diseases). The therapies comprise the combined use of inhibitors of BTK, mTOR kinase, and Bcl-2 or their signaling pathways, and immunomodulatory drugs. Also described are pharmaceutical compositions and kits comprising these inhibitors.

The invention belongs to the fields of organic synthesis and pharmaceutical chemistry, and relates to a total synthesis preparation method and an application of natural product flavonoid compounds. The method comprises the following steps: respectively carrying out a 4-step reaction and a 8-step reaction on 2,4,6-trihydroxyacetophenone used as a raw material to complete total synthesis of a natural product Morin (1); and respectively carrying out a 7-step reaction and a 9-step reaction on the Morin (1) used as a raw material to complete total synthesis of a natural product Sanggenol F (2). The method has the advantages of easily available raw materials, stable intermediate, mild conditions, easily controlled reaction, and important reference and utility values in massive production of the Morin and the Sanggenol F. The prepared Morin (1) can be used to prepare anti-oxidation drugs, anti-diabetes drugs, immunoloregulation drugs or antitumor drugs; and the prepared Sanggenol F can be used to prepare metabolic disease resisting drugs, and the metabolic disease resisting drugs are insulin sensitizers, blood sugar lowering drugs or blood fat lowering drugs.

the invention discloses a preparing method of extracellular polysaccharide of Bacillus subtilis and application in the tumour facet, which is characterized by the following: inhibiting tumour from growing; accelerating the growth of macrophage, leucocyte and lymph cell; fitting for health or immune adjusting drug.

The invention relates to a composition comprising at least one ISCOM complex and at least one internal antigen which is not a surface antigen and not in the form of a part of a whole micro-organism. The internal antigen may be a nucleoprotein or presented as a member of the group of components obtained after disintegrating a micro-organism. The ISCOM complex may be an ISCOM or ISCOM matrix complex. The composition may also comprise non internal antigens. The invention also elates to the composition for use as an immune stimulating medicine or vaccine, especially for use in eliciting T cell respond including CTL respond. The invention also relate to a composition comprising at least one ISCOM complex for use as an immune stimulating or immune modulating medicine or vaccine for the stimulation of dendritic ceils in elderly. Further, the invention relates to a process for preparing a composition wherein a saponin, cholesterol and a lipid are mixed with a lysed cell suspension of cells and solubilising agent without removal of any cell components, where after the solubilising agent is removed or diluted. It also relates to a kit.

The invention deals with a pharmaceutical composition comprising lectin KM+ to prevent and heal epithelial wounds. The invention also comprises the use of lectin KM+, obtained from the plant (Artocarpus integrifolia) or recombinant (expression heterologue) to prepare medicaments.

The invention provides an anti-tumor and immune-modulating composition, a preparation method and an application of the composition in preparing anti-tumor and immune-modulating medicines. The preparation composition is formed by mixing 1 to 20 parts of broccoli extracting solution, 0.5 to 1 part of chitosan oligosaccharide, 1 to 2 parts of ganoderan, 1 to 2 parts of cordyceps polysaccharide and 1 to 2 parts of dextrin in parts by weight; the preparation composition is characterized in that the content of sulforaphane is 2 to 15 mg / g and the content of polysaccharide is 200 to 400 mg / g in the preparation composition; the preparation method comprises the following steps: crushing, porphyrizing, filtering, hydrolyzing and macroporous resin adsorption separating broccoli seeds or corms to obtain a water solution containing sulforaphane, uniformly mixing the broccoli extracting solution, chitosan oligosaccharide, ganoderan, cordyceps polysaccharide and dextrin with water, spray drying into fine powder, preparing into granules, tablets, capsules and the like. Animals researches prove that the compound polysaccharide preparation has remarkable effects on improving immunity and suppressing tumors.

The present invention is one kind of medicine composition containing active matter extracted from male agaric, and its preparation process and application in preparing anticancer medicine, immunity regulating medicine, hypotensor and hypoglycemic. The medicine composition includes active matter extracted from male agaric and pharmaceutically acceptable carrier, and the active matter is mixture of polysaccharide PT1 of molecular weight 11-15 KDa and proteoglycan PT2 of molecular weight 17-23 KDa in the weight ratio of 1 to 1.5-4.

The invention discloses a class of amino propanediol derivatives, a preparation method, drug compositions and uses thereof, and particularly relates to a class of new immunoloregulation agents represented by a general formula (I), a preparation method, drug compositions containing the immunoloregulation agents, and especially uses of the immunoloregulation agents as immunoloregulation drugs. The compound with characteristics of excellent treatment effect and low toxicity can be used in the fields of immunologic derangement and immunosuppression, and can further be used for treatment of hypoimmunity, organ transplant rejection and autoimmune diseases. The formula I is defined in the instruction.

The invention discloses a human alpha-defensin-5 modifier and applications thereof, and belongs to the technical field of biology. The modifier is obtained in the mode that amino acid residues are added at the C tail end of human alpha-defensin-5, and fatty acid is modified and connected to the amino acid residues for modifying; at least one amino acid residue has a free amino group in the added amino acid residues, and the fatty acid with 8-24 carbon atoms is modified and connected on the free amino group. The invention further discloses the applications of the human alpha-defensin-5 modifier to preparing antibacterial medicine and immune adjustment medicine. According to the human alpha-defensin-5 modifier and the applications thereof, the C tail end of the HD-5 extends and is modified, and the antibacterial activity is remarkably enhanced; particularly, Lys extending at the C tail end of the HD-5 is subjected to myristic acid modification, the salt resistance of the modifier can be obviously improved, the limitation of the sensibility of traditional antibacterial peptide salt is broken through, and the human alpha-defensin-5 modifier has important clinical application prospects; macrophage can be remarkably allowed to release inflammatory factors through the modifier, and the human alpha-defensin-5 modifier can be applied to preparing of the immune adjustment medicine.

The invention relates to a long-acting hypoglycemic and lipid-regulating polypeptide and application thereof. The amino acid sequence of the polypeptide is HGEGTFT SDVSSYLEGQAAKEFIAWLVKGRGPGVLGGGCRCIPALDSLTPANED. The application of the polypeptide is to prepare drugs or pharmaceutical compositions for the treating or preventing of type 1 diabetes and type 2 diabetes, and to prepare immunomodulatory drugs or pharmaceutical compositions. The long-acting hypoglycemic and lipid-regulating polypeptide can be used for achieving pharmacodynamic effect duration of up to 10 hours. The polypeptide is abifunctional polypeptide, the polypeptide can not only be the same as GLP-1 analogue, reduce the blood sugar and glycosylated hemoglobin of the type 1 diabetes patients, reduce the blood sugar, inhibit eating and reduce the glycosylated hemoglobin of the type 2 diabetes patients, but also can regulate immunity and inhibit pathological immune attacks as well as the VP peptid..

The invention relates to the technical field of medicine, in particular to an application of a TIPE2 (tumor necrosis factor-alpha induced protein 8 like-2) agonist in immunoregulation drugs for treating endotoxin sepsis complicated with acute lung injury. A model of the endotoxin sepsis complicated with acute lung injury is established, the protection effect testing of the TIPE2 agonist on the sepsis complicated with acute lung injury is performed, and the regulating function of a TIPE2 agonist on the sepsis immune system is achieved, so that the organism damage caused by excessive activation of the immune system can be prevented. According to the invention, exact laboratory data is provided for treatment of sepsis complicated with acute lung injury by the aid of the TIPE2 agonist, and corresponding scientific basis is further provided for an immunomodulatory therapeutic mechanism with the application of the TIPE2 agonist clinically.

An instant solid injection of taxane for improving immunity is prepared through preparing solution A from taxol or polyenyltaxol, polyoxyvinyl castor oil or tween-80 or glycol laurylhydroxy stearate, and alcohol, preparing solution B from propanediol, hyaluronic acid, high-purity water and mannitol or glucose, slurry adding the solution B to solution A while stirring, homogenizing while emulsifying vacuum removal of alcohol, and freeze (or spray) drying.

The invention relates to application of a short peptide miPEP155 to preparation of an immunoregulation medicament. The short peptide is derived from a host gene of micro RNA155, and is named as miPEP155. The miPEP155 polypeptide can restrain the differentiation of Th17 cells, has an immunoregulation function, and can be used for preventing or treating autoimmune diseases.

A vaccine comprising an immunogenic preparation containing a plasmodium antigen or a fragment thereof, wherein said antigen is selected from a group consisting of PyAg2, PfAg2, PvAg2, PkAg2, PoAg2, PmAg2, PbAg2, PcAg2 and a combination thereof. A vaccination method comprising administering a priming immunization preparation containing a plasmodium antigen or fragment thereof, wherein said antigen is selected from a group consisting of PyAg2, PfAg2, PvAg2, PkAg2, PoAg2, PmAg2, PbAg2, PcAg2 and a combination thereof, and administrating a boosting immunization preparation containing said plasmodium antigen or fragment, wherein said antigen is selected from a group consisting of PyAg2, PfAg2, PvAg2, PkAg2, PoAg2, PmAg2, PbAg2, PcAg2 and a combination thereof. The vaccination method further comprising co-administration of an immune modulating drug.50

The present invention belongs to the technical field of medicine, and particularly to the field of vaccines and immunizations, more particularly to a radix achyranthis bidentatae crude polysaccharide, a radix achyranthis bidentatae polysaccharide component and a radix achyranthis bidentatae homogeneous polysaccharide extracted from radix achyranthis bidentatae, wherein the radix achyranthis bidentatae crude polysaccharide is selected from a radix achyranthis bidentatae crude polysaccharide 1 and a radix achyranthis bidentatae crude polysaccharide 2, wherein the radix achyranthis bidentatae crude polysaccharide 1 mainly comprises fructose, has a molecular weight of 1000-3000 Da, and preferably contains a small amount of glucose, and the radix achyranthis bidentatae crude polysaccharide 2 mainly comprises arabinose, glucose, Rhamnose, galactose and galacturonic acid, and has a molecular weight of 1.0*10<4>-2.0*10<5>Da. The present invention further relates to a pharmaceutical composition containing the polysaccharide, preparation methods of the polysaccharides, and vaccine uses of the polysaccharides. According to the present invention, the radix achyranthis bidentatae crude polysaccharide, the radix achyranthis bidentatae polysaccharide component and the radix achyranthis bidentatae homogeneous polysaccharide respectively have good immunoadjuvant activity and good immunomodulatory effects, and have the potential in preparation of vaccine adjuvants and immunomodulatory drugs.

The invention discloses a thymic active isomer and preparing method for industrial manufacturing domain, which possesses amino sequence as X-Arg-Lys-Y-Val, wherein X is acetyl or hydrogen or random sequence with at least 70% isogenesis as the amino sequence; Y is Asp or Glu; Lys or Glu is substituted by corresponding beta-or delta-amino sequence. The invention also provides its medical utility, which can produce immune adjusting drug, tumour-resistance drug and oxidation resistance drug.

The invention provides an application of vorinostat for preparation of immunomodulatory drugs. New properties of vorinostat are determined through a large quantity of experiments and include that vorinostat can inhibit STAT-1 and STAT-3 signal pathways, so that naive T cells are inhibited from differentiating to Th1 and Th17 lymphocytes, and IFN-gamma and IL-17 expression quantities are reduced; vorinostat can increase the number of nTreg cells of CD4<+>CD25<+>Foxp3<+>; vorinostat can inhibit expression of NF-kappa B P65, thereby inhibiting the expression quantity of TNF-alpha and relieving infiltration of macrophages; vorinostat can further increase the expression quantity of tight junction protein claudin-5, and accordingly, blood retinal barrier injury is repaired. On the basis of the properties, the novel application of vorinostat as the immunomodulatory drug is determined, the application of vorinostat used for experimental autoimmune uveitis therapeutic drugs is further determined, and the experiments prove that vorinostat has definite curative effect on experimental autoimmune uveitis, has a brand-new treatment pathway, is free of side effects and has a good application prospect.

The invention belongs to the technical field of medicines and particularly relates to a ganoderma lucidum beta-glucan, a preparation method thereof and an application thereof to preparing immunomodulatory drugs. The molecular weight of the Ganoderma lucidum beta-glucan is 5-500 kDa; the monosaccharide composition comprises glucose and glucuronic acid; the ratio of the two monosaccharides is 30:1-4:1; the connection mode mainly comprises ->3) Glc (beta1-> and->6) Glc (beta1->; and the ratio of the two connection modes is 1:1-3:1. The preparation method comprises the steps of carrying out hot water extraction on ganoderma lucidum medicinal materials to remove water-soluble polysaccharides; extracting residue by using an alkali solution, neutralizing extract by using hydrochloric acid and concentrating; precipitating by using ethanol to obtain a crude polysaccharide; and purifying the crude polysaccharide by using anion exchange resin to finally obtain the high-purity beta-glucan. Provedby cell experiments, the beta-glucan disclosed by the invention is capable of significantly promoting the process of phagocytosing neutral red by RAW264.7 cells and can be used for preparing the immunomodulatory drugs.

The invention discloses a preparation method of homopolysaccharide which exists in ganoderma sinensis submerged fermentation mycelium and has a novel structure, and applications of the homopolysaccharide in the preparation of antineoplastic drugs and immune adjustment drugs. The homopolysaccharide is characterized in that the total polysaccharide content of the homopolysaccharide is more than 95%, the molecular weight of the homopolysaccharide is 10000-30000 Daltons, and preferentially is 21190 Daltons, and the homopolysaccharide has the characteristics of high efficiency, low toxicity and immunity enhancement in the antineoplastic application. The homopolysaccharide in the ganoderma sinensis submerged fermentation mycelium, provided by the invention, is high in polysaccharide content and purity, and is excellent in administration dosage, and the preparation method is suitable for industrial production.

Immunomodulatory pharmaceutical composition, each pharmaceutical dosage unit contains interleukin-25u~1500u, interferon 15u~1000u, thymosin 0.5ug~25ug, transfer factor 0.00002u~0.0015u, hydrocortisone 30ug~150ug, and is made of poultry eggs As an attachment agent, the above drug is added into poultry eggs, stirred evenly, dried and crushed into powder, and packed into capsules. The pharmaceutical composition can induce and stimulate the immune response to achieve the purposes of curing, preventing and maintaining health. Due to the small dose of active ingredients, there is no adverse toxic or side effect. After treating abdominal smooth muscle spasm, allergic purpura, diabetes, and vertigo, the curative effect is satisfactory.

The invention relates to fusion protein with double functions of inhibiting revascularization of a tumor microenvironment and activating adaptive immune response, and a gene and application thereof. The invention discloses a group of recombinant protein with Tumstatin and CD137L double functions, and is characterized in that the protein is formed by fusing Tumstatin active segment amino acid sequence (one of SEQ ID NO. 52 to SEQ ID NO. 55) and CD137L extracellular domain protein segment amino acid sequence (one of SEQ ID NO. 64 to SEQ ID NO. 66) through flexible connecting peptide. The protein and the protein coding gene can be applied to research and application of tumor angiogenesis inhibitors, various oncology related diseases and body immunity adjusting medicines.