Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

64 results about "Isolated heart" patented technology

Isolated HEART system. The isolated heart system is a versatile solution for pharmacological researchers investigating mice, rats, guinea-pigs or rabbits hearts, in health and disease, or following drug challenges. cardiac electrophysiological and mechanical parameters.

Heart-lung preparation and method of use

An isolated heart or heart-lung preparation in which essentially normal pumping activity of all four chambers of the heart is preserved, allowing for the use of the preparation in conjunction with investigations of electrode leads, catheters, ablation methods, cardiac implants and other medical devices intended to be used in or on a beating heart. The system can be designed to be used within a Magnetic Resonance Imaging (MRI) unit or a X-ray computed tomography (CT) scanner. The preparation may also be employed to investigate heart and lung functions, in the presence or absence of such medical devices. In order to allow comparative imaging visualizations of either or simultaneously the heart and/or lung structures and devices located within the chambers of the heart or vessels or bronchi within the lungs, a clear perfusate such as a modified Krebs buffer solution with oxygenation is circulated through all four chambers of the heart and thus the coronary and/or pulmonary vasculatures. A ventilator with intubation tube can be used to inflate/deflate the lungs and/or provide oxygen to the isolated organs. The preparation and recordings of the preparation may be used in conjunction with the design, development and evaluation of devices for use in or on the heart and/or lungs, as well as for use as an investigational and teaching aid to assist physicians and students in understanding the operation of the cardiopulmonary system.
Owner:MEDTRONIC INC

High-purity polyphyllin VI preparation method and application

The invention relates to a high-purity polyphyllin VI preparation method and an application, and belongs to the field of Chinese herbal medicine extraction and separation. The method includes the specific steps: roughly crushing Chinese paris rhizome or wake robin medicinal materials, performing ethanol extraction; sequentially performing macroporous adsorption resin, silica gel and reverse-phase material column chromatography on extracting solution; taking ethyl acetate, ethanol and water as eluting agents and filtering, washing and drying sedimentation portions after recovering solvents by eluent to obtain high-purity polyphyllin VI. The method has the advantages that the operation steps are easily repeated, conditions are easily controlled and amplified, the solvents are low in toxicity and easy to recover, and the like. The obtained polyphyllin VI is basically free from organic solvent residues, and the purity of the polyphyllin VI reaches 98% or more. After pharmacodynamical research of the influence of mouse normal pressure hypoxia tolerance, mouse brain ischemia caused by common carotid artery ligation, rat myocardium injury caused by ischemia reperfusion, myocardial infarction caused by rat isolated heart myocardial ischemia and the like, the polyphyllin VI serving as a final product is good in effect and can be used for developing products for treating cardiovascular and cerebrovascular diseases.
Owner:YUNNAN INST OF MATERIA MEDICA

Constant-temperature incubator for isolated perfused heart

The invention discloses a constant-temperature incubator for an isolated perfused heart. The constant-temperature incubator for an isolated perfused heart comprises an incubator body and a mobile device, wherein a test tank and a heating tank are formed in the incubator body; the test tank is connected with the heating tank, is subjected to heat exchange with the heating tank through a heat conductor, and is communicated with an external liquid inlet pipe; a drain pipe is arranged at the bottom of the test tank; and the mobile device is located above the incubator body and is used for driving an external liquid inlet pipe to move forward and backward and up and down. According to the constant-temperature incubator, the isolated heart is put into the test tank; heat exchange is carried out between the test tank and the heating tank through the heat conductor so that a constant physiological temperature environment is provided for incubation of the isolated heart; the mobile device is used for driving the external liquid inlet pipe to synchronously move forward and backward and up and down together with the perfused isolated heart so as to ensure that the isolated heart can be adjusted to a proper position; the isolated heart is stably fixed through a transparent element and a heart fixing device; implementation of a photographing or electrocardiosignal recording and stimulating procedure is facilitated; and incubation of the isolated heart and detection of related tests are facilitated.
Owner:GUANGDONG HOSPITAL OF TRADITIONAL CHINESE MEDICINE

Isolated heart transfer box

The invention discloses an isolated heart transfer box. A heart fixing shell is connected inside a limiting shell; the limiting shell is detachably connected inside a temperature regulating shell; theheart fixing shell is in the shape of a heart external structure; the heart fixing shell is of a screen-shaped structure; the limiting shell is of a screen-shaped structure; and a temperature regulating pipeline is arranged inside the temperature regulating shell, so that the temperature regulating pipeline controls the temperature of a medium inside the temperature regulating shell. The isolatedheart transfer box solves the problem that an isolated heart easily moves inside the transfer box and then is damaged as the positioning fixing effect for the isolated heart is not strong in an isolated heart transfer process in the prior art. According to the isolated heart transfer box disclosed by the invention, the isolated heart is fixed by the heart fixing shell, and the isolated heart is buffered and protected through the heart fixing shell, the limiting shell and a connecting structure between the heart fixing shell and the limiting shell as well as a connecting structure between thelimiting shell and the temperature regulating shell, so that the isolated heart is prevented from being damaged, and therefore, the isolated heart is completely protected, and life characteristics ofthe isolated heart are guaranteed to not damage.
Owner:王寅

Nifedipine medicine composition and preparation method thereof

The invention discloses a nifedipine medicine composition and a preparation method thereof. The nifedipine medicine composition contains nifedipine, hydroxymethyl propyl cellulose and microcrystalline cellulose. The hydroxymethyl propyl cellulose is used as slow-releasing framework material; the weight ratio of the nifedipine and the hydroxymethyl propyl cellulose is 2:1-1:1; and the weight ratio of the nifedipine and the microcrystalline cellulose is 1:4-1:3; and lactose, starch, calcium hydrophosphate and glucose can be also added. The method for preparing the nifedipine medicine composition comprises the following steps of: (1) crushing and screening; (2) drying; and (3) tabletting. According to the invention, the dissolution rate of the nifedipine in the water can be increased, the coronary arteries in the normal blood supply area and the ischemic area are relaxed while the absorption rate of the nifedipine in the body is increased so that coronarospasm and is released and prevented and myocardial contraction is inhibited; myocardial oxygen consumption is reduced; the peripheral resistance is released; after load of heart is reduced; sinus node function and atrioventricular conduction of the isolated heart are slowed down; and the nifedipine medicine composition is applicable to variant angina pectoris, unstable angina pectoris and chronic stable angina pectoris.
Owner:JILIN AODONG GROUP DALIAN PHARMACEUTICAL CO LTD

Normal-temperature in-vitro heart transfer device

The invention relates to a normal-temperature in-vitro heart transfer device which comprises a protective shell, a first cover and a base, universal wheels are arranged at the bottom of the base, a temperature adjusting pipeline is arranged on the inner wall of the protective shell, a partition plate is arranged in the protective shell, and a heart storage device is arranged above the partition plate. The heart storage device is fixedly connected with the partition plate through a fixing rod. A peristaltic pump, a heart perfusate storage device, a temperature changer, a membrane oxygenator anda heart perfusate filter are arranged on the upper part of the base, and the heart storage device, the heart perfusate filter, the peristaltic pump, the heart perfusate storage device, the temperature changer and the membrane oxygenator are sequentially communicated through a perfusate conveying pipe. The cardiac perfusate filter is positioned on the bottom end surface of the partition plate; a buzzer, an operation panel and a control box are arranged on the front end face of the protective shell, and a second cover is arranged on the lower portion of the front end face of the protective shell.
Owner:李建朝

In-vitro heart valve testing system and testing method thereof

PendingCN110478083AEasy to guide design improvementsUniversalMeasurement devicesHeart valvesPower equipmentLeft ventricular apex
The invention discloses an in-vitro heart valve testing system and a testing method thereof, the testing system comprises a simulated heart, a circulating device and a monitoring device, the simulatedheart has a complete heart structure, a circulating path and a puncture port for simulating release of the heart valve, and the simulated heart is an animal isolated heart; the circulating device comprises power equipment and liquid storage equipment, and the power equipment is connected with a left ventricular apex part or / and a right ventricular apex part of the simulated heart and used for providing power for the simulated heart; the liquid storage equipment is used for providing circulating liquid for the test system; the circulating device is connected with the simulated heart to form aleft heart circulating system and / or a right heart circulating system, the left heart circulating system is used for testing a mitral valve and / or an aortic valve, and the right heart circulating system is used for testing a tricuspid valve and / or a pulmonary valve; the monitoring device comprises a pressure monitoring device, and the pressure monitoring device is used for detecting pressure changes before and after the interventional valve is released. The system provided by the invention has universality and a wide application range.
Owner:PEIJIA MEDICAL TECH SUZHOU

Coix seed small fried dough twists and making method thereof

The invention discloses coix seed small fried dough twists and a making method thereof. According to the coix seed small fried dough twists disclosed by the invention, coix seed powder is used as a preparation raw material of the small fried dough twists, the coix seed powder also contains special functional components of coixol, coixenolide, coix seed polysaccharide, triterpene compounds, flavonoid compounds and the like besides general nutrient substances of protein, fat, minerals, vitamins and the like, and early-stage pharmacology research indicates that the coix seeds have the efficacy ofresolving heat, tranquilizing the mind, alleviating pain and the like, and have exciting effects on isolated heart, intestines and uteruses. Modern pharmacology research indicates that functional components of the coix seeds have pharmacological activity of resisting tumors, enhancing immunity, reducing blood sugar, reducing blood calcium, reducing blood pressure, resisting viruses, restraining trypsin, inducing ovulation and the like. The small fried dough twists made from the coix seed powder can effectively increase the general nutrient components of the protein, minerals, the vitamins andthe like, as well as the functional components of the coixenolide, the coix seed polysaccharide and the like, the fried dough twists are balanced in nutrition, the effects of preserving the health and being health care can be achieved, and the fried dough twists have unique flavor and mouth feel, and are excellent in palatability.
Owner:GUIZHOU UNIV

Polypeptide for constructing long QT syndrome animal model

ActiveCN111892660AQT prolongationSimple and reliable method of establishmentPolypeptide with localisation/targeting motifCalcium binding proteinsPhysiologyGuinea pig
The invention belongs to the field of animal experiment modeling methods, and relates to a polypeptide for constructing a long QT syndrome animal model and a method for establishing an animal model for an animal experiment. According to the polypeptide for constructing the long QT syndrome animal model, an amino acid sequence of the polypeptide is GRKKRRQRRRGEVDEMIREADIDGDGQVNYEGFVQMM, and the polypeptide is named as CM4. The method for establishing the long QT syndrome animal model comprises the step of administering the polypeptide CM4 to an animal to obtain the long QT syndrome animal model. The model establishing method provided by the invention is simple and reliable, and is convenient for researchers to establish a long QT syndrome mouse or guinea pig isolated heart model and carry out related experimental researches. The modeling process is simple and effective, meanwhile, a corresponding control group can be set, and electrocardiogram changes before and after amino acid mutation are compared and analyzed. The CM4 is given to induce the QT interval of isolated hearts of mice and guinea pigs to be prolonged, the CM4 is easy to obtain and high in purity, the CM4 can penetratethrough cell membranes to enter cells to play a role, the activity of myocardial calcium channels is adjusted, the molding efficiency is high, the cost is low, and research of related experiments is facilitated.
Owner:中国医科大学

Isolated heart perfusion experiment device and isolated heart perfusion experiment method

The invention discloses an isolated heart perfusion experiment device. The isolated heart perfusion experiment device comprises a heart perfusion device with a perfusion catheter and a remaining needle. The remaining needle comprises a puncture needle and a catheter of which two ends are opened. The rear end of the catheter is fixedly provided with a fixing connector which is used for detachably connecting the liquid outlet end of the perfusion catheter. The fixing connector is provided with a port communicated with a cavity of the catheter. The front end of the puncture needle successively passes through the port and the cavity of the catheter. The isolated heart perfusion experiment device is used, so that a heart taken from a laboratory mice body can be conveniently and rapidly suspended on a heart perfusion device by an operator, and the activity of the taken heart is guaranteed. The invention further discloses an isolated heart perfusion experiment method using the isolated heartperfusion experiment device.
Owner:THE FIRST AFFILIATED HOSPITAL OF XIAMEN UNIV +1

Incubator for in-vitro heart experiment

The invention discloses an incubator for an in-vitro heart experiment. The incubator comprises a box body, a top cover and a front cover, wherein the top cover is detachably connected to the top of the box body, and the front cover is detachably connected to the front side of the box body. The box body comprises side plates and a bottom plate, wherein inner cavities are formed in the side plates and the bottom plate correspondingly, the inner cavities in the side plates and the inner cavity in the bottom plate are communicated with each other to form an integrated closed heat preservation cavity, heat preservation liquid is arranged in the heat preservation cavity, and two liquid passing pipes communicated with the heat preservation cavity are arranged on the side plates and are served as an inlet and an outlet for heat-insulating liquid respectively. The heat preservation cavity is formed in the box body, the heat preservation liquid is uninterruptedly circulated in the heat preservation cavity, a constant-temperature environment is created in the box body, a perfusion device is matched to enable an isolated heart to be in a constant-temperature state all the time in the experiment process, and the accuracy of the experiment result is guaranteed.
Owner:CAPITAL UNIVERSITY OF MEDICAL SCIENCES

An isolated heart transfer box

The invention discloses an isolated heart transfer box. A heart fixing shell is connected inside a limiting shell; the limiting shell is detachably connected inside a temperature regulating shell; theheart fixing shell is in the shape of a heart external structure; the heart fixing shell is of a screen-shaped structure; the limiting shell is of a screen-shaped structure; and a temperature regulating pipeline is arranged inside the temperature regulating shell, so that the temperature regulating pipeline controls the temperature of a medium inside the temperature regulating shell. The isolatedheart transfer box solves the problem that an isolated heart easily moves inside the transfer box and then is damaged as the positioning fixing effect for the isolated heart is not strong in an isolated heart transfer process in the prior art. According to the isolated heart transfer box disclosed by the invention, the isolated heart is fixed by the heart fixing shell, and the isolated heart is buffered and protected through the heart fixing shell, the limiting shell and a connecting structure between the heart fixing shell and the limiting shell as well as a connecting structure between thelimiting shell and the temperature regulating shell, so that the isolated heart is prevented from being damaged, and therefore, the isolated heart is completely protected, and life characteristics ofthe isolated heart are guaranteed to not damage.
Owner:王寅

Method and system for ex-vivo heart perfusion

Systems and methods for performing perfusion and contractility assessments for a heart are provided. The system can operate in any of Langendorff mode, pump-supported working mode, passive working mode, and right-sided working mode. The system includes a reservoir from which one or more pumps are operable to supply a heart with fluids and collect fluids output therefrom. One or more clamps can beused to switch between Langendorff, pump-supported, passive, and right-sided working modes.
Owner:UNIV HEALTH NETWORK
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products