61 results about "Monoclonal antibody therapy" patented technology

An antibody capable of recognizing amyloid β while not recognizing amyloid β precursor proteins, and a method for using the same.

A monoclonal antibody characterized by being capable of recognizing the N-terminus peptide of amyloid β while not recognizing amyloid β precursor proteins, an amyloid β assay kit, a therapeutic agent of Alzheimer's disease, and a method for treating Alzheimer's disease using the monoclonal antibody.

The present invention relates to methods and compositions for the prevention and treatment and prevention of immune system disorders, including cancer, AIDS, asthmatic disorders, autoimmune diseases, organ transplant rejection and chronic viral diseases such as HCV or HBV infections. The therapeutic methods of the invention comprise administering molecules that modulate the activity of 8F4, thereby modulating costimulation of T cells. The present invention further provides monoclonal antibodies against the 8F4 molecule and hybridoma cells which produce said monoclonal antibodies. Pharmaceutical compositions comprising molecules that modulate the activity of 8F4 are also provided.

The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.

The monoclonal antibodies that only recognise the O-acetylated form of the GD2 ganglioside, or fragments of the antibody, for the diagnosis and the treatment of cancers in which the cells express the O-acetylated GD2, the antibody or the fragment recognising the O-acetylated GD2 molecules expressed by the tumoral cells and not recognising the GD2 molecules expressed at the surface of the peripheral nerves, in order to increase the specificity of the diagnosis and reduce the toxicity of the treatments. Also artificially modified antibodies advantageously used for treating and diagnosing cancers in which the cells express the O-acetylated GD2.

The invention relates to a hybrid tumor cell strain capable of secreting high neutralizing activity CDV (canine distemper virus) monoclonal antibody. A hybrid tumor cell strain 1D7 is selected from a hybrid tumor cell bank containing 82 strains which secrete CDV monoclonal antibody, and is used for preparing mouse ascitic antibody which has neutralizing potency up to 106 to CDV. The hybrid tumor cell strain capable of secreting high neutralizing activity CDV monoclonal antibody is high in neutralizing potency and resistant to CDV strains in a wide range, and has evident treatment effect on CDattached dogs, minks or foxes in clinical treatment, and is safe without adverse side effects. The monoclonal antibody therapeutic agent prepared with the hybrid tumor cell strain has stable neutralizing potency after two years of storage, and is high in stability.

Plant viral vectors have great potential in rapid production of proteins, but no simple. Here a geminivirus-based system for high-yield and rapid production of oligomeric protein complexes, including virus-like particle (VLP) vaccines and monoclonal antibodies (mAbs) is described. In particular, a single vector that contains two non-competing replicons for transient expression in Nicotiana benthamiana leaves is described. The correct assembly of these subunit proteins into functional oligomeric structures (VLPs or full-size mAb) is also described. This system advances plant transient expression technology by eliminating the need for non-competing viruses, and thus, enhances the realistic commercial application of this technology for producing multiple-subunit protein complexes.

Methods for treating cancer by co-administering a therapeutic monoclonal antibody with IL-21 are described. Exemplary monoclonal antibodies that can be used are rituximab, trastuzumab and anti-CTLA-4 antibodies. The enhanced antitumor of the combination therapy is particularly useful for patient populations that are recalcitrant to monoclonal therapy, relapse after treatment with monoclonal antibodies or where the enhanced IL-21 antitumor effect reduces toxicities associated with treatment using the monoclonal antibodies.

The invention relates to a preparation containing Fusobacterium nucleatum and PD-L1 antibody and used for immunotherapy of colorectal cancer, application of the preparation, a Fusobacterium nucleatummarker to predict curative effect of PD-L1 antibody therapy of colorectal cancer, and application of the marker. The influence of Fusobacterium nucleatum upon PD-L1 antibody immunotherapy of colorectal cancer is studied deeply herein, and it is discovered that PD-L1 monoclonal antibody therapy is more effective to colorectal cancer in the presence of Fusobacterium nucleatum, while PD-L1 monoclonalantibody therapy helps evidently extend the lifetime of a mouse with colorectal cancer in the presence of Fusobacterium nucleatum; by discussing the mechanism of Fusobacterium nucleatum, it is discovered that Fusobacterium nucleatum can provide transcriptional control for the expression of PD-L1; after PD-L1 antibody therapy is carried out for colorectal cancer tissues in the presence of Fusobacterium nucleatum, the proportion of CD8 positive T cells is increased; all these above are good for the effect of PD-L1 antibody therapy. It is indicated that the presence or absence of Fusobacterium nucleatum is suitable for acting as a potential marker to judge the curative effect of PD-L1 monoclonal antibody therapy for the patient with colorectal cancer; Fusobacterium nucleatum and PD-L1 monoclonal antibody can form an immunotherapy preparation for patients with colorectal cancer.

The present invention provides a microfabricated device and methods for high throughput single cell screening of a heterogeneous population. The present invention is partly based upon but not limited to sorting by monitoring cell secreted factors that accumulate in time (hours, days, weeks) as cells are cultured in the microbubble well niche the architecture of which facilitate the accumulation. In certain embodiments, the device and method comprises a means to identify effective drugs for personalize therapeutics such as but not limited to discovery of monoclonal antibody therapeutics.

The invention provides a reagent kit and a method for detecting the expression quantities of antigens of acute myelogenous leukemia granulocytes. Reagents of the reagent kit comprise percp-labeled CD45-resistant antibodies, FITC-labeled CD15-resistant antibodies and PE-labeled CD33-resistant antibodies. The reagent kit is applied to the method, and the expression quantities of the CD33 antigens of the granulocytes (non-stem/progenitor cells) in peripheral blood and bone marrow of AML (acute myelogenous leukemia) patients can be detected by the aid of flow cytometry. Compared with the traditional flow cytometry mainly for measuring target expression antigen cell proportions and qualitatively analyzing the target expression antigen cell proportions, the reagent kit and the method have the advantages that the expression of the CD33 antigens of the myelogenous leukemia granulocytes can be quickly and accurately quantitatively detected and analyzed by the aid of the reagent kit and the method, detection results can be used for evaluating curative effects of AML monoclonal antibody therapy, targeted therapy for AML by the aid of CD33 monoclonal antibody medicines can be effectively guided, and extremely important effects can be realized in related medical detection fields.