62 results about "Monoclonal antibody therapy" patented technology

The present invention provides methods of treating, preventing or ameliorating the symptoms of T cell-mediated immunological diseases, particularly autoimmune diseases, through the use of anti-CD3 antibodies. In particular, the methods of the invention provide for administration of antibodies that specifically bind the epsilon subunit within the human CD3 complex. Such antibodies modulate the T cell receptor / alloantigen interaction and, thus, regulate the T cell mediated cytotoxicity associated with autoimmune disorders. Additionally, the invention provides for modification of the anti-CD3 antibodies such that they exhibit reduced or eliminated effector function and T cell activation as compared to non-modified anti-CD3 antibodies.

An antibody capable of recognizing amyloid β while not recognizing amyloid β precursor proteins, and a method for using the same.A monoclonal antibody characterized by being capable of recognizing the N-terminus peptide of amyloid β while not recognizing amyloid β precursor proteins, an amyloid β assay kit, a therapeutic agent of Alzheimer's disease, and a method for treating Alzheimer's disease using the monoclonal antibody.

The present invention relates to methods and compositions for the prevention and treatment and prevention of immune system disorders, including cancer, AIDS, asthmatic disorders, autoimmune diseases, organ transplant rejection and chronic viral diseases such as HCV or HBV infections. The therapeutic methods of the invention comprise administering molecules that modulate the activity of 8F4, thereby modulating costimulation of T cells. The present invention further provides monoclonal antibodies against the 8F4 molecule and hybridoma cells which produce said monoclonal antibodies. Pharmaceutical compositions comprising molecules that modulate the activity of 8F4 are also provided.

Monoclonal antibodies which can bind to the ClfA protein and which are generated from binding subdomains or active fragments of the ClfA protein from Staphylococcus aureus, including the active fragments proteins from its fibrinogen binding domain such as Clf40 protein, the Clf33 protein, or ClfA N3, are provided which can be useful in the treatment and protection against infection from staphylococcal bacteria such as Staphylococcus aureus. In addition, medical instruments can be treated using the monoclonal antibodies of the invention in order to reduce or eliminate the possibility of their becoming infected or further spreading the infection. In particular, the antibodies of the present invention are advantageous because they can prevent adherence of the bacteria to host cells by impairing or inhibiting the ability of S. aureus ClfA to bind to fibrinogen or fibrin, and thus can be utilized in methods or treating or preventing staphylococcal inventions.

The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.

The present invention provides methods of treating, preventing or ameliorating the symptoms of T cell-mediated immunological diseases, particularly autoimmune diseases, through the use of anti-CD3 antibodies. In particular, the methods of the invention provide for administration of antibodies that specifically bind the epsilon subunit within the human CD3 complex. Such antibodies modulate the T cell receptor / alloantigen interaction and, thus, regulate the T cell mediated cytotoxicity associated with autoimmune disorders. Additionally, the invention provides for modification of the anti-CD3 antibodies such that they exhibit reduced or eliminated effector function and T cell activation as compared to non-modified anti-CD3 antibodies.

Monoclonal antibodies which can bind to the ClfA protein and which are generated from binding subdomains or active fragments of the ClfA protein from Staphylococcus aureus, including the active fragments proteins from its fibrinogen binding domain such as Clf40 protein, the Clf33 protein, or ClfA N3, are provided which can be useful in the treatment and protection against infection from staphylococcal bacteria such as Staphylococcus aureus. In addition, medical instruments can be treated using the monoclonal antibodies of the invention in order to reduce or eliminate the possibility of their becoming infected or further spreading the infection. In particular, the antibodies of the present invention are advantageous because they can prevent adherence of the bacteria to host cells by impairing or inhibiting the ability of S. aureus ClfA to bind to fibrinogen or fibrin, and thus can be utilized in methods or treating or preventing staphylococcal inventions.

The monoclonal antibodies that only recognise the O-acetylated form of the GD2 ganglioside, or fragments of the antibody, for the diagnosis and the treatment of cancers in which the cells express the O-acetylated GD2, the antibody or the fragment recognising the O-acetylated GD2 molecules expressed by the tumoral cells and not recognising the GD2 molecules expressed at the surface of the peripheral nerves, in order to increase the specificity of the diagnosis and reduce the toxicity of the treatments. Also artificially modified antibodies advantageously used for treating and diagnosing cancers in which the cells express the O-acetylated GD2.

Plant viral vectors have great potential in rapid production of proteins, but no simple. Here a geminivirus-based system for high-yield and rapid production of oligomeric protein complexes, including virus-like particle (VLP) vaccines and monoclonal antibodies (mAbs) is described. In particular, a single vector that contains two non-competing replicons for transient expression in Nicotiana benthamiana leaves is described. The correct assembly of these subunit proteins into functional oligomeric structures (VLPs or full-size mAb) is also described. This system advances plant transient expression technology by eliminating the need for non-competing viruses, and thus, enhances the realistic commercial application of this technology for producing multiple-subunit protein complexes.

Disclosed is a pharmaceutical composition for the treatment or prevention of hepatitis B virus infection, comprising a 1:3 mixture of two fully human anti HBsAg monoclonal antibodies 19.79.5 and 17.1.41. Also disclosed are preferred modes of administration. The pharmaceutical composition can be given as a monotherapy or in combination with other anti viral agents.

The invention relates to a hybrid tumor cell strain capable of secreting high neutralizing activity CDV (canine distemper virus) monoclonal antibody. A hybrid tumor cell strain 1D7 is selected from a hybrid tumor cell bank containing 82 strains which secrete CDV monoclonal antibody, and is used for preparing mouse ascitic antibody which has neutralizing potency up to 106 to CDV. The hybrid tumor cell strain capable of secreting high neutralizing activity CDV monoclonal antibody is high in neutralizing potency and resistant to CDV strains in a wide range, and has evident treatment effect on CDattached dogs, minks or foxes in clinical treatment, and is safe without adverse side effects. The monoclonal antibody therapeutic agent prepared with the hybrid tumor cell strain has stable neutralizing potency after two years of storage, and is high in stability.

The invention relates to a hybridoma cell strain secreting a high-neutralization activity infectious bursal disease virus (IBDV) monoclonal antibody, and belongs to the field of biotechnology. The hybridoma cell strain C128 is screened from an established bank of hybridoma cells secreting the IBDV monoclonal antibody, and a mice ascites monoclonal antibody prepared by the hybridoma cell strain has IBDV neutralization titer of 1010. The high-neutralization activity IBDV monoclonal antibody secreted by the hybridoma cell strain C128 has high neutralization titer and a wide IBDV strain resistance range, can be used for clinical treatment on IBD-infected animals, and has obvious curative effects, good safety and no adverse side reaction. A monoclonal antibody preparation prepared by the hybridoma cell strain C128 keeps neutralization titer after being preserved for 2 years and has good stability.

Plant viral vectors have great potential in rapid production of proteins, but no simple. Here a geminivirus-based system for high-yield and rapid production of oligomeric protein complexes, including virus-like particle (VLP) vaccines and monoclonal antibodies (mAbs) is described. In particular, a single vector that contains two non-competing replicons for transient expression in Nicotiana benthamiana leaves is described. The correct assembly of these subunit proteins into functional oligomeric structures (VLPs or full-size mAb) is also described. This system advances plant transient expression technology by eliminating the need for non-competing viruses, and thus, enhances the realistic commercial application of this technology for producing multiple-subunit protein complexes.

The present invention describes the plant-based production of a therapeutic antibody against West Nile Virus.

The invention relates to the use of monoclonal antibodies that only recognise the O-acetylated form of the GD2 ganglioside, or fragments of said antibody, for the diagnosis and the treatment of cancers in which the cells express the O-acetylated GD2, said antibody or said fragment recognising the O-acetylated GD2 molecules expressed by the tumoral cells and not recognising the GD2 molecules expressed at the surface of the peripheral nerves, in order to increase the specificity of the diagnosis and reduce the toxicity of the treatments. The invention also relates to artificially modified antibodies advantageously used for treating and diagnosing cancers in which the cells express the O-acetylated GD2.

The present invention provides methods of treating, preventing, slowing the progression of, or ameliorating the symptoms of T cell mediated immunological diseases, particularly autoimmune diseases (e.g., autoimmune diabetes (i.e. type 1 diabetes or insulin-dependent diabetes mellitus (IDDM)) and multiple sclerosis) through the use of anti-human CD3 antibodies. The antibodies of the invention of the invention are preferably used in low dose dosing regimens, chronic dosing regimens or regimens that involve redosing after a certain period of time. The methods of the invention provide for administration of antibodies that specifically bind the epsilon subunit within the human CD3 complex. Such antibodies modulate the T cell receptor / alloantigen interaction and, thus, regulate the T cell mediated cytotoxicity associated with autoimmune disorders. Additionally, the methods of the invention provide for use of anti-human CD3 antibodies modified such that they exhibit reduced or eliminated effector function and T cell activation as compared to non-modified anti-human CD3 antibodies.

The present invention relates to monoclonal antibodies that specifically bind to human pituitary adenylate cyclase activating polypeptide (PACAP) and pharmaceutical compositions comprising such antibodies. Methods of treating or preventing headache conditions, such as migraine and cluster headache, using the monoclonal antibodies are also described.

A method of treating cancer by co-administering a therapeutic monoclonal antibody and IL-21 is described. Exemplary monoclonal antibodies that may be used are rituximab, trastuzumab, and anti-CTLA-4 antibodies. For patient populations resistant to monoclonal antibody therapy, relapsed after treatment with monoclonal antibodies, or in which enhanced IL-21 antitumor effects reduce toxicity associated with therapy with monoclonal antibodies, the The enhanced antitumor properties of the combination therapy described above are particularly useful.

The invention relates to application of bone marrow mesenchymal stem cells combined with monoclonal antibodies in cancer treatment. Monoclonal antibodies specifically aiming at the liver cancer are obtained through screening, the antibodies have a good effect of inhibiting proliferation of liver cancer cells Huh-7 and HepG2 at the same time, meanwhile it is confirmed in a mouse model test that the monoclonal antibodies have a good effect of inhibiting proliferation of tumors in a mouse body, and the antibodies and mesenchymal stem cells are combined for treating liver cancer to generate a synergistic effect, so that the antibodies have a relatively good application prospect.

Methods for treating cancer by co-administering a therapeutic monoclonal antibody with IL-21 are described. Exemplary monoclonal antibodies that can be used are rituximab, trastuzumab and anti-CTLA-4 antibodies. The enhanced antitumor of the combination therapy is particularly useful for patient populations that are recalcitrant to monoclonal therapy, relapse after treatment with monoclonal antibodies or where the enhanced IL-21 antitumor effect reduces toxicities associated with treatment using the monoclonal antibodies.

The invention discloses a neutralizing monoclonal antibody 3D8 identified HTNV-GP specific B cell epitope and key amino acid residue sequence of the epitope for treating hemorrhagic fever with renal syndrome (HFRS) caused by hantaan virus (HTNV) infection. The B cell epitope has an amino acid sequence of 882GFLCPEFPGSFRKKC896. The epitope peptide can be applied to study of mechanism of 3D8 neutralizing monoclonal antibody in treatment of HFRS, or preparation of drug for treating HFRS and preparation of novel vaccine strain aiming at hantaan virus 76-118, or development of novel diagnostic kitfor hantaan virus 76-118 as a target protein. The invention has good prospects of development and application in the field of HFRS specific immunotherapy.

The invention relates to a preparation containing Fusobacterium nucleatum and PD-L1 antibody and used for immunotherapy of colorectal cancer, application of the preparation, a Fusobacterium nucleatummarker to predict curative effect of PD-L1 antibody therapy of colorectal cancer, and application of the marker. The influence of Fusobacterium nucleatum upon PD-L1 antibody immunotherapy of colorectal cancer is studied deeply herein, and it is discovered that PD-L1 monoclonal antibody therapy is more effective to colorectal cancer in the presence of Fusobacterium nucleatum, while PD-L1 monoclonalantibody therapy helps evidently extend the lifetime of a mouse with colorectal cancer in the presence of Fusobacterium nucleatum; by discussing the mechanism of Fusobacterium nucleatum, it is discovered that Fusobacterium nucleatum can provide transcriptional control for the expression of PD-L1; after PD-L1 antibody therapy is carried out for colorectal cancer tissues in the presence of Fusobacterium nucleatum, the proportion of CD8 positive T cells is increased; all these above are good for the effect of PD-L1 antibody therapy. It is indicated that the presence or absence of Fusobacterium nucleatum is suitable for acting as a potential marker to judge the curative effect of PD-L1 monoclonal antibody therapy for the patient with colorectal cancer; Fusobacterium nucleatum and PD-L1 monoclonal antibody can form an immunotherapy preparation for patients with colorectal cancer.

The present invention provides a microfabricated device and methods for high throughput single cell screening of a heterogeneous population. The present invention is partly based upon but not limited to sorting by monitoring cell secreted factors that accumulate in time (hours, days, weeks) as cells are cultured in the microbubble well niche the architecture of which facilitate the accumulation. In certain embodiments, the device and method comprises a means to identify effective drugs for personalize therapeutics such as but not limited to discovery of monoclonal antibody therapeutics.

The invention provides a reagent kit and a method for detecting the expression quantities of antigens of acute myelogenous leukemia granulocytes. Reagents of the reagent kit comprise percp-labeled CD45-resistant antibodies, FITC-labeled CD15-resistant antibodies and PE-labeled CD33-resistant antibodies. The reagent kit is applied to the method, and the expression quantities of the CD33 antigens of the granulocytes (non-stem / progenitor cells) in peripheral blood and bone marrow of AML (acute myelogenous leukemia) patients can be detected by the aid of flow cytometry. Compared with the traditional flow cytometry mainly for measuring target expression antigen cell proportions and qualitatively analyzing the target expression antigen cell proportions, the reagent kit and the method have the advantages that the expression of the CD33 antigens of the myelogenous leukemia granulocytes can be quickly and accurately quantitatively detected and analyzed by the aid of the reagent kit and the method, detection results can be used for evaluating curative effects of AML monoclonal antibody therapy, targeted therapy for AML by the aid of CD33 monoclonal antibody medicines can be effectively guided, and extremely important effects can be realized in related medical detection fields.

The invention relates to a hybrid tumor cell strain capable of secreting high neutralizing activity CDV (canine distemper virus) monoclonal antibody. A hybrid tumor cell strain 1D7 is selected from a hybrid tumor cell bank containing 82 strains which secrete CDV monoclonal antibody, and is used for preparing mouse ascitic antibody which has neutralizing potency up to 106 to CDV. The hybrid tumor cell strain capable of secreting high neutralizing activity CDV monoclonal antibody is high in neutralizing potency and resistant to CDV strains in a wide range, and has evident treatment effect on CDattached dogs, minks or foxes in clinical treatment, and is safe without adverse side effects. The monoclonal antibody therapeutic agent prepared with the hybrid tumor cell strain has stable neutralizing potency after two years of storage, and is high in stability.

The invention provides a vaccine based on an epitope simulating human vascular endothelial growth factor VEGF, as well as a preparation method thereof. A VEGF mimic epitope which is specifically affinitive with human-mouse chimeric monoclonal antibody Avastin is screened out by use of a phage random presentation technique, and the amino acid sequence of the mimic epitope is Asp-His-Thr-Leu-Tyr-Thr-Pro-Tyr-His-Thr-His-Pro; the mimic epitope has no homology with the protein sequence of VEGF. A vaccine which can induce a polypeptide epitope aiming at VEGF molecular autoantibody in vivo is constructed on the basis of the mimic epitope. The invention provides a strategy for developing and designing the tumor therapeutic vaccine, which is targeted at the VEGF. The VEGF is one of molecules which has the strongest effect of promoting vascular growth, and is an ideal target for resisting angiogenesis and treating tumors. Therefore, the vaccine replaces or replenishes monoclonal antibody passive immunotherapy with an active immunity mode, so as to lay foundations for overcoming the defects of monoclonal antibody therapy.

Methods of therapy for treating a subject for multiple myeloma are provided. The methods comprise administering a therapeutically effective amount of an antagonist anti-CD40 antibody or antigen-binding fragment thereof to a patient in need thereof. The antagonist anti-CD40 antibody or antigen-binding fragment thereof is free of significant agonist activity, but exhibits antagonist activity when the antibody binds a CD40 antigen on a human CD40-expressing cell. Antagonist activity of the anti- antibody or antigen-binding fragment thereof beneficially inhibits proliferation and / or differentiation of human CD40 expressing multiple myeloma cells.

An anti-granulysin antibody, or an scFv or Fab fragment thereof, capable of binding to an epitope region from R64 to R113 of granulysin and capable of neutralizing an activity of granulysin. The antibody may contain a sequence selected from the sequences of SEQ ID NO:82 to SEQ ID NO:195, or the antibody may contain a sequence selected from the sequences of SEQ ID NO:39 to SEQ ID NO:76. The antibody may be a monoclonal antibody. A method for treating or preventing an unwanted immune response disorder includes administering to a subject in need thereof an effective amount of an anti-granulysin antibody capable of neutralizing the activity of granulysin. The unwanted immune response disorder may be SJS, TEN, or GVHD.