31 results about "Protein dimer" patented technology

The invention provides methods and compositions for the modulation of EGFR activity. In particular, inhibition of EGFR activation through an allosteric mechanism is discloses, as is a method for targeted drug discovery and design based on models of the three dimensional structure of the kinase domains of the protein dimers.

The invention relates to a method for selecting compounds having a modulating effect on the activation state of a dimer of VFT domain proteins expressed in cellular membranes in a measuring medium, said dimer including a first protein and a second protein which are identical or different, wherein the method includes the following steps: (a) marking the first and second proteins in the N-terminal portion of the VFT domain by members of a FRET partner pair, the Forster radius (R0) of said pair ranging between 20 and 55 Angstrom; (b) measuring the FRET signal in the absence and in the presence of the compound to be tested within a predetermined time window; (c) selecting the compound to be tested as a modulating compound if a difference in the FRET signal in the absence and in the presence of the compound to be tested is measured during step (b). The invention can be used in the research for new drugs and new taste modulators.

The present invention generally provides methods for the site-specific modification of peptides, polypeptides, and proteins, e.g., granulocyte macrophage colony-stimulating factor, human superoxide dismutase, annexin, leptin, antibodies and the like, cytokines and chemokines, at their N-termini and at sites at which unnatural aminoacids have been introduced along the protein framework. The modifications described herein can be used for the synthesis and application of the adducts in radio-labeling, molecular imaging and protein therapeutic applications, and the treatment of disorders such as rheumatoid arthritis, lupus erythematosus, psoriasis, multiple sclerosis, type-1 diabetes, Crohn's disease, and systemic sclerosis, Alzheimer disease, cancer, liver disease (e.g., alcoholic liver disease), and cachexia.

The invention relates to a method for selecting compounds having a modulating effect on the activation state of a dimer of VFT-domain proteins expressed in cell membranes present in a measuring medium, said dimer consisting of a first protein and of a second protein, said proteins being identical or different, wherein this method comprises the following steps:(a) labeling the first and second proteins in the N-terminal portion of their VFT domains with the members of a pair of FRET partners, the Förster radius (R0) of said pair being between 20 and 55 Å;(b) measuring the FRET signal in the absence and in the presence of the test compound within a predetermined time window;(c) selecting the test compound as a modulating compound if a difference in FRET signal in the absence and in the presence of test compound is measured in step (b).The invention can be used in the search for new medicaments and new taste modulators.

The invention discloses a subunit coronavirus vaccine for dimerization-based receptor binding domains and belongs to the technical field of medicine. A baculovirus expresses RBD (receptor binding domain (E367-Y606) of MERS-CoV (middle east respiratory syndrome coronavirus) protein and RBD (R294-F515) of SARS-CoV (severe acute respiratory syndrome coronavirus) in insect cells, the RBDs may form a dimer through cysteine residue at 603 of S (spike) protein or form a dimer through cysteine residue at 512 of the S protein, and purified RBD protein dimer and monomer are used respectively to immunize Bald / c mice. The dimerized RBDs have the advantages that the defect that RBD monomers have poor immunogenicity is overcome and the generation of neutralizing antibodies in against MERS-CoV is increased greatly.

The present invention relates to bispecific molecules comprising an EGFR binding domain and a distinct IGFIR binding domain for use in diagnostic, research and therapeutic applications. The invention further relates to cells comprising such proteins, polynucleotide encoding such proteins or fragments thereof, and vectors comprising the polynucleotides encoding the innovative proteins. Exemplary bispecific molecules include antibody-like protein dimers based on the tenth fibronectin type III domain.

An artificial binding protein that can specifically recognize allophycocyanin, its amino acid sequence is: HMVDNKFNKEIVNAITEIHHLPNLNLEQRWAFIFSLFDDPSQSANLLAEAKKLNDAQAPKSGGGGSGGGGIGVDNKFNKEWQNAHNEIIWLPNLNWEQKWAFINSLYDDPSQSANLLAEAKKLNDAQAPKAAASDYKDDDDKLEHHH. The protein has the characteristics of strong specificity, high affinity, strong thermal stability, strong acid-base tolerance and the like, and can be applied in the fields of detection and purification of allophycocyanin and the like. In addition, the present invention also relates to a DNA fragment for encoding the above-mentioned artificial binding protein and a method for obtaining the artificial binding protein. In the present invention, by selecting highly stable and highly soluble protein A dimer as the backbone protein, on the basis of it, through processes such as genetic engineering transformation, construction of mutant library, affinity screening, etc., the finally obtained class has antigen binding active protein.

The invention discloses a stable coronavirus recombinant protein dimer and its expression vector. The coronavirus recombinant protein consists of the coronavirus S protein S-RBD, the CTD region N-CTD of the coronavirus N protein and the connection connecting the two Sub composition. The coronavirus recombinant protein of some examples of the present invention can form and maintain a stable dimer structure, avoid the degradation of the monomer S-RBD, help improve the immunogenicity of the coronavirus recombinant protein, and is expected to be used for the preparation of raw materials for detection reagents and vaccines , antibodies, prophylactic or therapeutic drugs. The coronavirus recombinant protein dimers of some examples of the present invention have good immunogenicity. It has broad application prospects in the field of vaccine development. The expression vectors of some examples of the present invention are easy to express coronavirus recombinant protein dimers and have high expression levels.

The invention belongs to the field of genetic engineering, and relates to a zipper fastener structure for promoting formation of protein dimer and application thereof, and the zipper fastener structure can be used for dimerization of homoprotein and heteroprotein, and can also be used for polypeptide ring formation, dimerization polypeptide and polypeptide extension. Some examples can obtain the ESAT6-CFP10 dimer close to native conformation, the dimer has better solubility, and the memory T cell stimulation effect of the dimer is better than that of ESAT6-CFP10 protein of linear fusion expression. The inventor also finds that the dimer zipper buckle can help to form a more stable cyclic polypeptide, and the CCP polypeptide added with the dimer buckle can increase the detection rate of citrullinated autoantibody in the serum of a patient with rheumatoid arthritis.

A protein dipolymer structure predicting method based on differential evolution includes the steps of firstly, predicting structural information of two chains of protein dipolymers through an I-TASSERsever so as to improve the prediction precision of the space structure of each single chain of protein; secondly, converting the existing protein dipolymer structure predicting problem into the optimal individual search optimizing problem through the design of population individuals so as to reduce the calculation price; thirdly, searching for the optimal individual through a differential evolution algorithm so as to improve the prediction precision of the protein dipolymer structure. The protein dipolymer structure predicting method based on differential evolution is low in calculation priceand high in search efficiency.

The present invention discloses a recombinant human osteoplastic protein-1 renaturation and its preparation preparation method. It utilizes chromatography to obtain rh OP-1 monomer protein whose purity is above 95%. Said invention also provides the concrete steps of said preparation method, including: in 2M-6M urea or 1M-4M guanidine hydrochloride buffer solution making dialysis and renaturation, pH value of renaturation buffer solution is 8.0-10, renaturation temperature is room temperature or 4deg.C and renaturation time is 24-96 hr, then further making chromatographic purification, dialysis, sterilization, packaging and freeze-drying so as to obtain the renaturation preparation of recombinant human osteoplastic protein-1. Besides, said invention also provides the application method of said renaturation preparation of recombinant human osteoplastic protein-1.