Product
Patsnap Eureka
For R&D, Patsnap Eureka makes reading and utilizing patents & technical documents easy.
Patsnap Eureka AIR
Designed for self-driven R&D workflows. Generate viable solutions, solve complex R&D challenges, empower your innovation with AI.
Patsnap Eureka Materials
Designed for material experts only. Revolutionize your material R&D, from search, analyze, to developing new materials.
Feature
TechResearch
Generate reliable direction feasibility study reports for your R&D in just a few steps.
TechSeek
Discover and master advanced knowledge NOW. Basics, ideas, possibilities, all at once.
TechMind
As an expert in R&D Theories, TechMind can generates customized viable solutions instantly.
TechRisk
Analyze your overall solution with one click, know your potential R&D risks in advance.
TechMonitor
Get weekly tech updates, stay abreast of the latest tech innovations and key insights.
Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
37results about How to "Broad antimicrobial spectrum" patented technology
Efficacy Topic
Property
Owner
Technical Advancement
Application Domain
Technology Topic
Technology Field Word
Patent Country/Region
Patent Type
Patent Status
Application Year
Inventor
Cephem compound having catechol group
InactiveUS9145425B2Broad antimicrobial spectrumAntibacterial agentsOrganic active ingredientsSide chainPharmaceutical medicine
This invention provides Cephem compounds having the formula:or an ester, a protected compound at the amino on the ring in the 7-side chain, a pharmaceutically acceptable salt, or a solvate thereof, a pharmaceutical composition thereof, and a method for treating a bacterial infectious disease with the compound, the ester, the protected compound, the salt, or the solvate thereof, wherein the symbols in the formula are defined in the specification. The compounds exhibit potent antimicrobial spectrum against a variety of bacteria including Gram negative bacteria and / or Gram positive bacteria, preferably beta-lactamase producing Gram negative bacteria, more preferably, multi-drug resistant microbials, in particular, Class B type metallo-beta-lactamase producing Gram negative bacteria, and still preferably extended-spectrum beta-lactamase (ESBL) producing bacteria. The compounds most preferably do not exhibit cross-resistance against known Cephem drugs or Carbapenem drugs.
Owner:SHIONOGI & CO LTD
Children antimicrobial peptides Cathelicidins and preparation method and applications thereof
InactiveCN102127549AAvoid killing effectEfficient expressionAntibacterial agentsAntimycoticsChemical synthesisNucleotide
The invention discloses children antimicrobial peptides cathelicidins, a preparation method and the applications thereof. The nucleotide sequence and the amino acid sequence of children antimicrobial peptides Cathelicidin1, Cathelicidin2 and Cathelicidin3 are shown as a sequence table. The preparation method of the antimicrobial peptides adopts a solid-phase chemical synthesis method or a geneticengineering method. The genetic engineering method comprises the following steps of: respectively cloning the encoding genes of mature children antimicrobial peptides Cathelicidin1-3 to expression vectors; and then, guiding into host cells to express. By applying the genetic engineering technology in the invention, the children antimicrobial peptides Cathelicidins are expressed in the prokaryotichost cells with high efficiency. Proved by experiments, the antimicrobial peptides have obvious inhibition on various gram-positive bacteria and negative bacteria.
Owner:POULTRY INST SHANDONG ACADEMY OF AGRI SCI
Cephem compound having catechol group
InactiveUS20130102583A1Broad antimicrobial spectrumAntibacterial agentsOrganic active ingredientsSide chainPharmaceutical medicine
A compound of the formula:whereinX is —N═, —CH═, or the like;W is —CH2— or the like;U is —S— or the like;R1 and R2 are each independently hydrogen, halogen, optionally substituted lower alkyl, or the like;R3 is hydrogen or the like;each R4 is independently hydrogen, halogen, or the like;m is an integer from 0 to 2;Q is a single bond, or the like;G is —C(═O)—, or the like;D is a single bond, —NH—, or the like; andE is a cyclic quaternary ammonium group,or an ester, a protected compound at the amino on the ring in the 7-side chain, a pharmaceutically acceptable salt, or a solvate thereof.
Owner:SHIONOGI & CO LTD
Cephem derivative having catechol group
InactiveUS9290515B2Broad antimicrobial spectrumHigh antibacterial activityAntibacterial agentsOrganic chemistryPharmaceutical medicinePerylene derivatives
Owner:SHIONOGI & CO LTD
A group of Cathelicidins antimicrobial peptides of chicken, preparation method and application thereof
InactiveCN102864154AAvoid killing effectEfficient expressionAntibacterial agentsAntimycoticsChemical synthesisCathelicidin 1
The invention discloses a group of Cathelicidins antimicrobial peptides of chicken, a preparation method and an application thereof. The nucleotide sequences and amino acid sequences of Cathelicidin 1 and Cathelicidin 3 antimicrobial peptides of the chicken are presented in a sequence table. The preparation method of the antimicrobial peptides is a solid phase chemical synthesis method or a gene engineering method, wherein the gene engineering method includes that coding genes of mature peptides of the Cathelicidin 1 and 3 antimicrobial peptides of the chicken are cloned on expression vectors respectively and then led to host cells for expression. According to the group of antimicrobial peptides, the preparation method and the application thereof, the Cathelicidins antimicrobial peptides of the chicken are efficiently expressed in pronucleus host cells by using the gene engineering technology, and experiments prove that the group of antimicrobial peptides has obvious inhibiting effects on a plurality of gram-positive bacteria and gram-negative bacteria.
Owner:POULTRY INST SHANDONG ACADEMY OF AGRI SCI
Novel aminoglycoside antibiotics
ActiveUS20090186841A1Broad antimicrobial spectrumGreat anti-microbial activityAntibacterial agentsBiocideAminoglycosideAnti-Microbial Agents
This invention relates to novel aminoglycoside antibiotics, which have potent antimicrobial activity against bacteria, which induce infectious diseases, particularly MRSA, and has no significant nephrotoxicity, and process for producing them. More particularly, the present invention relates to compounds represented by formula (Ia) or their pharmacologically acceptable salts or solvates, or their diastereomer mixtures, antimicrobial agents comprising them, and a process for producing them.
Owner:MICROBIAL CHEM RES FOUND +1
Yeast expressed chicken Cathelicidin antibacterial peptide as well as preparation method and application thereof
PendingCN105732792AAvoid killing effectEasy to separate and purifyAntibacterial agentsFungiPichia pastorisBiotechnology
The invention belongs to the field of biotechnology and particularly relates to pichia pastoris expressed recombinant chicken Cathelicidin antibacterial peptide and further discloses a preparation method and application thereof. In the method for preparing recombinant chicken Cathelicidin antibacterial peptide disclosed by the invention, a pPICZalphaA secreted expression vector is selected as a eukaryotic expression system of the exogenous gene so that the recombinant chicken Cathelicidin antibacterial peptide is efficiently expressed and direct killing of host cells caused by the expression product is avoided. Meanwhile, the method has the advantages of high expression efficiency, simple separation and purification of expression products, low production cost, easiness in magnification and good stability and is suitable for large-scale industrial production. According to experimental verification, the combination of Cathelicidin antibacterial peptide and antibiotic realizes an obvious synergistic antibacterial effect on multiple kinds of gram-positive bacteria and gram-negative bacteria, and the application and promotion prospects are broad.
Owner:POULTRY INST SHANDONG ACADEMY OF AGRI SCI
Bloody noun antibacterial peptide temporin-Lb, genes thereof and use in pharmacy
InactiveCN101503459ASimple structureEasy to synthesizePeptide/protein ingredientsPeptidesBacteroidesCDNA library
The invention relates to bullfrog antibiotic peptide temporin-Lb, genes thereof and the application in the pharmacy, belonging to the biomedicine field. The bullfrog antibiotic peptide genes are obtained by filtering in a constructed bullfrog skin c DNA library; wherein, the molecular weight is 1691.11 dalton; the isoelectric point is 9.70; the primary structure of the complete sequence of the polypeptide is Leu Phe Arg His Val Val Lys Ile PheGIu Lys Tyr Leu-AMIDATION. The genes of the coding bullfrog antibiotic peptide are composed of 322 position nucleotide acid; wherein, the coding mature peptide is 142nd-180th position nucleotide acid. The synthetic bullfrog antibiotic peptide has obvious function of inhibiting the growth of the bacterial and fungus and can be taken as therapeutic drug for preparing pathogenic microorganism infection diseases to be applied.
Owner:JILIN UNIV
Cephem derivative having catechol group
InactiveUS20140256697A1Broad antimicrobial spectrumHigh antibacterial activityAntibacterial agentsOrganic active ingredientsCephemCatechol
A compound represented by formula (I) or a pharmaceutically acceptable salt thereof wherein A represents a group represented by one of formulae (i)-(iii); B represents a group represented by formula (v) or (vi); and E represents a substituted or unsubstituted heterocyclic group having a cationic nitrogen atom.
Owner:SHIONOGI & CO LTD
A hylarana guentheri secretory peptide, a gene thereof and applications of the secretory peptide in pharmacy
ActiveCN106496317ASimple structureEasy to synthesizeAntibacterial agentsAntimycoticsFood additiveHylarana guentheri
The invention relates to a hylarana guentheri secretory peptide, a gene thereof and applications of the secretory peptide in pharmacy. The secretory peptide is an annular polypeptide formed by 43 amino acids. The amino acid sequence of the secretory peptide is shown as SEQ ID NO.1, and cysteine at the number 37 site and cysteine at the number 43 site form an intramolecular disulfide bond. The gene sequence of the secretory peptide is shown as SEQ ID NO.4, wherein the number 133 to number 261 nucleotides encode a functional mature hylarana guentheri secretory peptide. A mature functional polypeptide amino acid sequence is induced from the gene of the hylarana guentheri secretory peptide. The synthesized hylarana guentheri secretory peptide has high anti-bacterial, anti-influenza virus and antioxidant functions. The hylarana guentheri secretory peptide has characteristics of a simple structure and convenient artificial synthesis, and can be applied in medicines treating pathogenic microorganism infectious diseases and diseases caused by radical oxidation, beautifying and skincare medicines and food additives.
Owner:SOUTHERN MEDICAL UNIVERSITY
Rana grahami skin peptide, gene thereof and application in pharmacy
InactiveCN101012275ASimple structureEasy to synthesizePeptide/protein ingredientsAntiinfectivesDiseaseNucleotide composition
The invention discloses a non-finger frog skin peptide and gene and application in the drug in the biological medical domain, which codes a single-chained peptide with molecular weight at 3355.95 and isoelectric point at 10.14, wherein the primary structure of peptide is Gly Leu Gly Gly Ala Lys Lys Asn Phe Ile Ile Ala Ala Asn Lys Thr Ala Pro Gln Ser Val Lys Lys Thr Phe Ser Cys Lys Leu Tyr Asn Gly; the gene of secretory peptide is composed of 731 nucleic acids, which codes 520-616th nucleic acid; the peptide possesses obvious bacteria and fungi inhibiting action, which can be applied to make microbe infection disease drug.
Owner:KUNMING INST OF ZOOLOGY CHINESE ACAD OF SCI
Chicken Cathelicidins antibacterial peptide and preparation method and application for same
InactiveCN102911943AAvoid killing effectEfficient expressionAntibacterial agentsAntimycoticsChemical synthesisCathelicidin 1
The invention discloses a chicken Cathelicidins antibacterial peptide and a preparation method and application for the same. A nucleotide sequence of Cathelicidins 1 and a nucleotide sequence of Cathelicidins 2 of the chicken antibacterial peptide are shown in a sequence table. The preparation method for the antibacterial peptide is solid-phase chemical synthesis or a genetic engineering method. The genetic engineering method includes respectively cloning coding genes of mature peptides of the Cathelicidins 1 and coding genes of mature peptides of the Cathelicidins 2 of the chicken antibacterial peptide on expression vectors; and leading the expression vectors into host cells for expression. A genetic engineering technology is applied to efficiently express the chicken Cathelicidins antibacterial peptide in the host cells of a pronucleus, and as proved by experiments, the antibacterial peptide has an obvious suppression effect on various gram-positive bacteria and gram-negative bacteria.
Owner:POULTRY INST SHANDONG ACADEMY OF AGRI SCI
Aminoglycoside antibiotics
ActiveUS8148504B2Improve the level ofReduce sensitivityEsterified saccharide compoundsAntibacterial agentsBacteroidesNephrotoxicity
Owner:MICROBIAL CHEM RES FOUND +1
Rana rugulosa wiegmann antibacterial peptide, as well as gene and application thereof
InactiveCN107513100ASimple structureEasy to synthesizeAntibacterial agentsCosmetic preparationsFood additiveNucleotide
The invention relates to a rana rugulosa wiegmann antibacterial peptide, as well as gene and application in pharmacy. The rana rugulosa wiegmann antibacterial peptide is a ring-type polypeptide consisting of 12 amino acids, and has an amino acid sequence as shown in SEQ ID NO.1, wherein the 3nd cysteine and the 11th cysteine are complemented to form intramolecular disulfide bond, and the 12th tyrosine carries amidating modification. The gene sequence of the rana rugulosa wiegmann antibacterial peptide consists of SEQ ID NO.4, wherein a mature rana rugulosa wiegmann antibacterial peptide with coding function is nucleotide from 196 to 231. The mature functional polypeptide amino acid sequence is deduced by genes of the rana rugulosa wiegmann antibacterial peptide, and the synthesized rana rugulosa wiegmann antibacterial peptide has strong antibacterial and antioxidative functions. The rana rugulosa wiegmann antibacterial peptide has the characteristics of simple structure and convenience in artificial synthesis, can be applied to preparation of therapeutic medicines, beautifying and skin-protecting medicines and food additives for pathogenic microorganism infectious diseases and free radical oxidation.
Owner:SOUTHERN MEDICAL UNIVERSITY
Antibacterial peptide of brown-spotted torrential frog, its gene and application in drug preparation
InactiveCN100351270CSimple structureEasy to synthesizePeptide/protein ingredientsAntiinfectivesDiseaseBacteroides
The invention relates to an Amolops loloensis antibiotic peptide, its genes and use in pharmacy, wherein the antibiotic peptide is a single-chain polypeptide encoded by Amolops loloensis gnens, a Chinese amphiphyte, the molecular weight is 2666.4 Da, the isoelectric point is 9.70, the primary structure of the polypeptide sequence is: Phe Leu Pro Met Leu Ala Gly Leu Ala Ala Asn Phe Leu Pro Lys Leu Phe Cys Lys Ile Thr Lys Lys Cys-AMID. The gene that encodes the Amolops loloensis antibiotic peptide comprises 442 nucleotides, among which position No:247-318 nucleotides encode the ripened Amolops loloensis antibiotic peptide. The artificially synthesized Amolops loloensis antibiotic peptide has appreciable actions for inhibiting growth of bacteria and fungus, thus can be used as the medicament for treating diseases infected by pathogenic microorganism.
Owner:NANJING AGRICULTURAL UNIVERSITY
Ophthalmic gel medicinal composition and preparation method thereof
InactiveCN102961390AReasonable ratioBroad antimicrobial spectrumAntibacterial agentsOrganic active ingredientsBiomedical engineeringKeratitis
The invention discloses an ophthalmic gel medicinal composition and a preparation method thereof. The medicinal composition containing tobramycin and dexamethasone, disclosed by the invention, has the effect of treating anterior uveitis and keratitis; the ophthalmic gel medicinal composition is prepared through a scientific and reasonable production process; and the product is definite in function, controllable in quality and safe to take. The preparation method of the medicinal composition is simple, and the preparation process can be finished by conventional equipment.
Owner:XIAN TAKOMED PHARMA TECH
Yeast expressed chicken antibacterial peptide Cathelicidin 2 and preparation method and application thereof
InactiveCN105753959AAvoid killing effectEasy to separate and purifyAntibacterial agentsFungiBiotechnologyPichia pastoris
The invention belongs to the biotechnology field, particularly relates to a pichia pastoris-expressed recombinant chicken antibacterial peptide Cathelicidin 2, and further discloses a preparation method and application thereof.According to the preparation method of the recombinant chicken antibacterial peptide Cathelicidin 2, pPICZ alpha A secreting type expression vector is selected as an eukaryotic expression system of exogenous genes, the recombinant chicken antibacterial peptide Cathelicidin 2 is effectively expressed, and direct destruction caused by an expression product on host cells is avoided.Meanwhile, the method is high expression efficiency, the expression product is easy to separate and purify, the production cost is low, enlarging is easy, stability is good, and the method is suitable for large-scale industrial production.Experiments prove that the antibacterial peptide Cathelicidin 2 has the obvious synergistic antibacterial effect when used in cooperation with antibiotics, and has the wide application and popularization prospect.
Owner:POULTRY INST SHANDONG ACADEMY OF AGRI SCI
Hoplobatrachus rugulosus proteinase inhibition peptide and its gene and application of inhibition peptide in pharmacy
ActiveCN106478811ASimple structureInhibitory activityAntibacterial agentsCosmetic preparationsNucleotideAmino acid composition
The invention relates to an active polypeptide and its gene and an application of the inhibition peptide in pharmacy. The hoplobatrachus rugulosus proteinase inhibition peptide is cyclopeptide composed of 33 amino acids, a molecular weight is 3768.33 dalton, the isoelectric point is 6.303, and an amino acid sequence is SEQ ID NO.1, and a third cysteine and an eighth cysteine of the polypeptide form intramolecular disulfide bond. A gene sequence of the hoplobatrachus rugulosus proteinase inhibition peptide is composed of SEQ ID NO.4, wherein, the matured hoplobatrachus rugulosus proteinase inhibition peptide is 379th-477th site nucleotide. The hoplobatrachus rugulosus proteinase inhibition peptide has the characteristics of simple structure, convenient artificial synthesis, wide antibacterial spectrum, and strong activity. and can be taken as a medicine for treating pathogenic microorganism infectious diseases and a medicine having functions of beauty treatment and skin caring.
Owner:SOUTHERN MEDICAL UNIVERSITY
Antibacterial agents
ActiveUS20190161436A1Simple and inexpensive to prepareFeasible to scale-upAntibacterial agentsOrganic chemistryAntimicrobial compoundMedicinal chemistry
Owner:RUTGERS THE STATE UNIV
Imidazothiazole Derivatives and Process for Producing the Same
InactiveUS20080114164A1Inexpensive starting materialGreat anti-microbial activityAntibacterial agentsBiocideHalogenAlkaline earth metal
The present invention relates to compounds of formula (I) and a process for producing the same. In formula (I), X represents a halogen atom, and R1 represents group —COR2 wherein R2 represents group OM or C1-12 alkyloxy wherein M represents a hydrogen atom, an alkali metal, an alkaline earth metal, or quaternary ammonium. The use of this compound as a synthetic intermediate can realize the production of carbapenem derivatives having potent antimicrobial activity in an efficient and safe manner at low cost.
Owner:MEIJI SEIKA KAISHA LTD +1
Active polypeptide of brown-spotted torrential frog, its gene and application in drug preparation
InactiveCN100351271CSimple structureEasy to synthesizePeptide/protein ingredientsAntiinfectivesDiseaseNucleotide composition
The invention relates to an active polypeptide, its genes and use in pharmacy, wherein the active peptide is a single-chain polypeptide encoded by Amolops loloensis gnens, a Chinese amphiphyte, the molecular weight is 2664.36 Da, the isoelectric point is 9.70, the primary structure of the polypeptide sequence is Phe Leu Pro Leu Ala Val Ser Leu Ala Ala Asn Phe Leu Pro Lys Leu Phe Cys Lys Ile Thr Lys Lys Cys -AMIDATION. The gene that encodes the Amolops loloensis active peptide comprises 448 nucleotides, among which position No:247-318 nucleotides encode the ripened Amolops loloensis active peptide. The artificially synthesized Amolops loloensis active peptide has appreciable actions for inhibiting growth of bacteria and fungus, thus can be used as the medicament for treating diseases infected by pathogenic microorganism.
Owner:NANJING AGRICULTURAL UNIVERSITY
Cefdinir acid double salt and method for producing the same
ActiveUS8329895B2Improve stabilityImprove solubilityAntibacterial agentsOrganic active ingredientsSolubilityDouble salt
A compound represented by Formula I,wherein M represents Na+, K+, NH4+, or Cs+; and 1) when Y represents SO42−: when m=1, then n=1; and when m=0.5, then n=1.5; and 2) when Y represents PO43−, when m=1, then n=2. The compound has good solubility and high bioavailability and can be formulated into oral pharmaceutical preparations and pharmaceutical preparations for injections.
Owner:ZHEJIANG YONGNING PHARMA +1
Chicken antimicrobial peptides Cathelicidins and preparation method and applications thereof
InactiveCN102127549BAvoid killing effectEfficient expressionAntibacterial agentsAntimycoticsChemical synthesisNucleotide
Owner:POULTRY INST SHANDONG ACADEMY OF AGRI SCI
High-temperature-resistant environment-friendly plastic particle and preparation method thereof
InactiveCN111171425ABroad antimicrobial spectrumLong antibacterial timeLow-density polyethylenePolyvinyl chloride
The invention discloses a high-temperature-resistant environment-friendly plastic particle and a preparation method thereof, belonging to the technical field of plastic production. The high-temperature-resistant environment-friendly plastic particle comprises the following components: polyethylene, polyvinyl chloride, linear low-density polyethylene, titanium dioxide, a light stabilizer, an antibacterial agent, a reinforcing agent, an antioxidant, a heat stabilizer, a plasticizer and the like. The preparation method of the high-temperature-resistant environment-friendly plastic particle comprises the steps of raw material preparation, raw material component blending, extrusion granulation, cooling packaging and the like. The high-temperature-resistant environment-friendly plastic particleis not prone to breeding bacteria, fungi and viruses, wide in an antibacterial spectrum, capable of achieving continuous antibacterial action, long in antibacterial time, excellent in weather resistance and ageing resistance, long in service life, high in strength, good in toughness, good in heat resistance and good in environment friendliness. The preparation method is simple in process and easyto operate; the raw material components are blended through a mixing device, mixing efficiency is high, and mixing dead corners are effectively avoided; and the preparation method is suitable for massproduction.
Owner:江苏百兴管业科技有限公司
Copper coated antimicrobial filter material
PendingCN113750649AQuick kill effectBroad antimicrobial spectrumSemi-permeable membranesDispersed particle filtrationMicroorganismPhysical chemistry
The invention relates to a filter material, the filter material comprises an internal filter core material and a coating layer coated on the outer layer of the filter core material, and the coating layer is selected from one or more of copper, silver, zinc and gold and one or more alloys of the copper, the silver, the zin and the gold. The invention also relates to a filter article comprising the filter material. The filter material disclosed by the invention has the effects of quickly, efficiently and lastingly killing microorganisms and having a wide antimicrobial spectrum.
Owner:DINNOVATIVE NANJING CO LTD
2-thioethenyl substituted carbapenem derivatives
InactiveUS7687490B2Broad spectrum of and potent anitimicrobial activityHigh antibacterial activityAntibacterial agentsSilicon organic compoundsResistant bacteriaPyrococcus
Owner:MEIJI SEIKA KAISHA LTD
Scylla paramamosain antimicrobial peptide sparamosin and application thereof
ActiveUS20210061865A1Significant antimicrobial activityGreat anti-microbial activityAntibacterial agentsAntimycoticsBiotechnologyAntimikrobielle peptide
Provided is an antimicrobial peptide Sparamosin from Scylla paramamosain. The Sparamosin mature peptide and its functional domain Sparamosin26-54 were synthesized by solid-phase synthesis with a purity of over 95%. Both Sparamosin and Sparamosin26-54 exhibit strong antimicrobial activity. More importantly, Sparamosin26-54 has strong antifungal activity and could inhibit the growth of a variety of yeasts and filamentous fungi. Based on the potent antimicrobial activities of Sparamosin and Sparamosin26-54, both peptides could be developed as alternatives for conventional antibiotics, antimicrobial agents, feed additives in aquaculture and livestock, preservatives, and mold inhibitors.
Owner:XIAMEN UNIV
Rana grahami anti-microorganism polypeptide, gene thereof and application in pharmacy
InactiveCN101012278AInhibits bacterial and fungal growthBroad antimicrobial spectrumPeptide/protein ingredientsAntiinfectivesChemistryDisease
The invention discloses a non-finger microbe-proof peptide and gene and application in the drug in the biological medical domain, which codes a single-chained peptide with molecular weight at 3355.95 and isoelectric point at 11.47, wherein the primary structure of peptide is Gly Leu Phe Thr Leu Ile Lys Gly Ala Ala Lys Leu Ile Gly Lys Thr Val Pro Lys Lys Gln Ala Arg Leu Gly Met Asn Leu Trp Leu Val Lys Leu Pro Thr Asn Val Lys Thr (GLFTLIKGAAKLIGKTVPKKQARLGMNLWLVKLPTNVKT); the gene of secretory peptide is composed of 343 nucleic acids, which codes 123-240th nucleic acid; the peptide possesses obvious bacteria and fungi inhibiting action, which can be applied to make microbe infection disease drug.
Owner:KUNMING INST OF ZOOLOGY CHINESE ACAD OF SCI
Artificially synthesized antibacterial peptide and application thereof
ActiveCN113321707ASimple structureBroad antimicrobial spectrumAntibacterial agentsPeptide-nucleic acidsBiotechnologyAntibacterial activity
The invention provides a sequence of an artificially designed and synthesized antibacterial peptide and a preparation method thereof, and further provides application of the antibacterial peptide with different configurations to microorganism resistance. The antibacterial peptide disclosed by the invention has a remarkable effect of inhibiting the growth of bacteria and fungi. The antibacterial peptide disclosed by the invention has the beneficial characteristics of simple structure, artificial synthesis convenience and wide antibacterial spectrum; the full D-type and basic amino acids are composed of D-type amino acids, and the molecules have the characteristics of tolerance on degradation of various proteases, long antibacterial activity retention time and no drug residue; and the compound can be applied to prevention and treatment of infectious diseases of human or animals, artificial biological materials, food preservation, fruit and vegetable preservation and feed additives.
Owner:江苏亢钧生物科技有限公司
Who we serve
- R&D Engineer
- R&D Manager
- IP Professional
Why Patsnap Eureka
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com