Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

44 results about "Marine invertebrates" patented technology

Marine invertebrates are the invertebrates that live in marine habitats. Invertebrate is a blanket term that includes all animals apart from the vertebrate members of the chordate phylum. Invertebrates lack a vertebral column, and some have evolved a shell or a hard exoskeleton. As on land and in the air, marine invertebrates have a large variety of body plans, and have been categorised into over 30 phyla. They make up most of the macroscopic life in the oceans.

dsRNA induced specific and non-specific immunity in crustaceans and other invertebrates and biodelivery vehicles for use therein

Methods for inducing systemic, non-specific and / or sequence specific immune responses in invertebrates, e.g., marine invertebrates such as mollusks, porifera, ctenophora, echinodermas, marine worms, cnideria and preferably crustaceans, by the administration of at least one dsRNA, that confers immunity against a pathogen, or modulates expression of gene that affects growth, reproduction, and general health or "robustness" are provided. Also provided are methods of identifying invertebrate genes, e.g., crustacean genes, the expression of which is involved in the induction of non-specific (systemic) immune responses against pathogens. Also disclosed are preferred delivery systems and methods for stably administering at least one dsRNA to a crustacean whereby the dsRNA is administered via injection, immersion, in a feed or nutrient medium or comprised in a microorganism, e.g., yeast or microalgae, that expresses said dsRNA and is ingestible by said crustacean, e.g., a shrimp.
Owner:MUSC FOUND FOR RES DEV

Aquaculture system

A self-contained aquaculture system comprising a modular building defining a first main chamber for containing fish or marine invertebrates, a second swirl chamber comprising a primary filter communicating with the main chamber for removing solids from the main chamber, a drum filter for receiving and filtering water from the swirl chamber, a third biological filter chamber beneath the drum filter for receiving water therefrom and a biological filter tank. Water is pumped from the chamber. The building defines an enclosed space over the chambers, the temperature of which is controlled by an air conditioning unit. A foam fractionator, ultraviolet unit and ozone generator are used for treating the water in the main chamber.
Owner:CUMMINSCORP LTD

Synthetic diazonamides

The application discloses novel synthetic compounds, modeled after unique toxins extracted from the marine invertebrate Diazona angulata useful in the treatment abnormal cell mitosis. The application also discloses novel methods for synthesis of these compounds and methods of using these compounds.
Owner:BOARD OF RGT THE UNIV OF TEXAS SYST

Application of fucoidan in the preparation of medicine and health-care products for preventing and treating neurodegenerative diseases

The invention discloses a fucose sulfate or a compound whose active component is fucose sulfate, in the drug preparation on the treatment of nerve retrograde disease and cognition damage. And the invention discloses the relative application. The inventive fucose sulfate is mainly from marine invertebrate animal as sea-tangle, sea cucumber or the like, with wide resource, easy production, batch production, and wide application.
Owner:SHANDONG UNIV

Synthetic diazonamides

The application discloses novel synthetic compounds, modeled after unique toxins extracted from the marine invertebrate Diazona angulata useful in the treatment abnormal cell mitosis. The application also discloses novel methods for synthesis of these compounds and methods of using these compounds.
Owner:BOARD OF RGT THE UNIV OF TEXAS SYST

Marine phasolosma esculenta fibrinolytic enzyme, preparation method and applications thereof

InactiveCN103333875AControl or reduce transferAchieving a role in antitumor therapyPeptide/protein ingredientsEnzymesMarine invertebratesThrombus
The invention relates to fibrinolytic enzyme separated and prepared from a marine invertebrate, wherein 7 amino acid sequences on the N-terminal are NH2-IVGGRDV-OH, the molecule weight is about 35 kDa, and experimental study results show that the fibrinolytic enzyme and drug compositions thereof provide significant effects for anti-thrombus and stroke prevention and treatment, and further provide good effects in the field of tumor treatment.
Owner:许瑞安

Culture medium and method for culturing urechis unicinctus trochophore cell line

The invention discloses a culture medium and method for culturing a urechis unicinctus trochophore cell line. The culture medium is prepared by adding 20.2g / l of NaCl, 0.54g / l of KCl, 0.60g / l of CaCl2, 1g / l of MgSO4, 3.9g / l of MgCl2, 2.92g / l of L-glutamine, 5% of fetal bovine serum, 2% of urechis unicinctus coelomic fluid, 1% of urechis unicinctus yolk extract, penicillin with final contraction being 100IU / ml and streptomycin with final concentration being 100 microgram / ml into L-15 culture medium dry powder. The culture method is characterized in that the culture medium is used to perform trochophore single-cell primary culture, early passage is achieved, and subculturing is performed. The culture medium is high in specificity, can provide comprehensive nutrition to the cell growth and proliferation of the cell line and has great reference value to the building of other marine invertebrate trochophore cell lines.
Owner:OCEAN UNIV OF CHINA

Ocean Sipunculus nudus plasmin and its preparation and application

The invention relates to an ocean invertebrate plasmin which is a protein obtained by steps of homogenizing an ocean Sipunculus nudus digestive gland fluid, filtering to remove grease, freeze-drying, salting-out, desalinizing and carrying out DEAE chromatography and gel filtration chromatography. Amino acid sequence of the N-terminal part is Seq.2, and molecular weight is 15 KDa. It proves through experiment research that the plasmin has good effects of resisting thrombus and preventing and curing stroke.
Owner:许瑞安

Bacterial Product From Marive Origin, Useful For Preventing The Macro Biofouling Caused By Macroalgae And Marine Invertebrates

Extra-cellular product anti-biofouling against marine invertebrates which are common to the biofouling, which contains an extract of the supernatant of an Alteromonas sp. Culture. Anti-biofouling composition, comprising said extra-cellular product and a biopolymer. The use of said extra-cellular product for preparing a composition useful for inhibiting the marine micro- and macro-biofouling, and the process for preparing said extra-cellular product.
Owner:UNIV DE ANTOFAGASTA

Application of Green Technology Techniques to Construct a Biodegradable Artificial Reef

Artificial reefs serve a useful purpose to promote the growth of sessile marine organisms such as bacteria, algae, corals, and bryozoans as well as providing a habitat and food source for species such as fish, crabs, lobsters, and some marine invertebrates. This invention applies the United States Environmental Protection Agencies' Twelve Principles of Green Technology to provide a cellulose based surface that is coated in nutrients to promote the rapid growth of marine microbes, the base of the marine food chain. This rapid growth, which begins days after being submerged, starts the food chain. The mineral based substrate attached to the cellulose based material is denser than water to allow the entire structure to sink; both the cellulose and mineral based materials will degrade rapidly leaving behind nucleation sites for microbes, corals, invertebrate collections, and more. The reef is constructed entirely from biodegradable materials and production costs are economical.
Owner:MANNING THOMAS J

dsRNA induced specific and non-specific immunity in crustaceans and other invertebrates and biodelivery vehicles for use therein

Methods for inducing systemic, non-specific and / or sequence specific immune responses in invertebrates, e.g., marine invertebrates such as mollusks, porifera, ctenophora, echinodermas, marine worms, cnideria and preferably crustaceans, by the administration of at least one dsRNA, that confers immunity against a pathogen, or modulates expression of gene that affects growth, reproduction, and general health or “robustness” are provided. Also provided are methods of identifying invertebrate genes, e.g., crustacean genes, the expression of which is involved in the induction of non-specific (systemic) immune responses against pathogens. Also disclosed are preferred delivery systems and methods for stably administering at least one dsRNA to a crustacean whereby the dsRNA is administered via injection, immersion, in a feed or nutrient medium or comprised in a microorganism, e.g., yeast or microalgae, that expresses said dsRNA and is ingestible by said crustacean, e.g., a shrimp.
Owner:MUSC FOUND FOR RES DEV

Method and process for the production of collagen preparations from invertebrate marine animals and compositions thereof

InactiveUS7241871B2Cosmetic preparationsImpression capsMarine invertebratesFibrillar Collagens
The present invention relates to a process for the production of marine invertebrate type V telopeptide containing collagen preparations from marine invertebrates, compositions containing preparations, and methods of using these preparations. The collagen preparation includes telopeptide containing and optionally invertebrate atelopeptide containing, type V fibrillar collagen. The present collagen preparations may be employed in a variety of products including for example, cosmetic, pharmacological, dental, and cell culture products.
Owner:BIOSCI CONSULTANTS L L C

Bacterial product from marine origin, useful for preventing the macro and micro biofouling caused by macroalgae and marine invertebrates

Extra-cellular product anti-biofouling against marine invertebrates which are common to the biofouling, which contains an extract of the supernatant of an Alteromonas sp. Culture. Anti-biofouling composition, comprising said extra-cellular product and a biopolymer. The use of said extra-cellular product for preparing a composition useful for inhibiting the marine micro- and macro-biofouling, and the process for preparing said extra-cellular product.
Owner:UNIV DE ANTOFAGASTA

Preparation method of marine invertebrate blood cell suspension

The invention discloses a preparation method of a marine invertebrate blood cell suspension. The method simplifies the operation process, and maximally ensures the cell activity through the steps of uniformly mixing extracted blood cells with an anticoagulant, sieving, centrifuging, resuspending the cells with a balanced salt solution and the like, thereby obtaining the blood cell suspension with good cell state, high survival rate and few impurities. The method can be used for research on subsequent blood cell typing and functions of marine invertebrates.
Owner:BEIBU GULF UNIV

Method for culturing chlamys farreri trochophore cell line

The invention discloses a method for culturing a chlamys farreri trochophore cell line. A small amount of nutrient factors for keeping cell metabolism are added in a special cell culture medium for chlamys farreri trochophore, so that the good growth state of chlamys farreri trochophore larva in vitro culture cells is realized, and the stable subcultring of the cells can be realized along with cell division. The method is simple to operate and low in cost; the complete dissociation of the cells is realized by use of the combination of soaking in a special calcium-free sea-water iso-osmia buffer solution for the chlamys farreri trochophore and a mechanical method, without any digestion by enzymes; the method is little in damage of the chlamys farreri trochophore larva in vitro culture cells, low in cost, high in efficiency and repeatable; a stable marine invertebrate cell in vitro culture method is established and can realize the in vitro multiplication and the subcultring of the cell, the chlamys farreri trochophore cell line is the first continuous cell line of marine shells, and the method has an important guiding significance for cell line establishment of other shells except the chlamys farreri.
Owner:OCEAN UNIV OF CHINA

Marine invertebrate cell culture medium

The invention discloses a marine invertebrate cell culture medium, which comprises a basic culture medium and a natural culture medium. The natural culture medium is sea cucumber coelomic fluid. The sea cucumber coelomic fluid comes from marine invertebrates, can construct a growth environment more similar to the body for marine invertebrate cell lines, so that marine invertebrate cell lines can make full use of the abundant nutrients contained in the sea cucumber coelomic fluid to achieve the purposes of rapid growth and stable passage. The invention develops the biomass resources of the aquatic commercial animal sea cucumber's processing by-product coelomic fluid, the sea cucumber coelomic fluid capable of replacing serum for application is prepared, is applicable to long-term culture ofmarine invertebrate cells, not only provides support for the culture of marine invertebrate cells, but also realizes waste utilization. The preparation cost of sea cucumber coelomic fluid is much lower than that of bovine serum, thus also greatly lowering the preparation cost of the marine invertebrate cell culture medium.
Owner:ZHEJIANG OCEAN UNIV

Method and apparatus for propagating benthic marine invertebrates

An apparatus for propagating benthic marine invertebrates in water. The apparatus comprises (a) a culture cell, (b) a sedimentation chamber in fluid connection with the culture cell, and (c) a pump in fluid connection with the culture cell and with the sedimentation chamber capable of pumping water from the sedimentation chamber to the culture cell. Also disclosed is a method for propagating benthic marine invertebrates comprising culturing the invertebrates in a water environment in the apparatus.
Owner:RAMOT AT TEL AVIV UNIV LTD

Ruditapes philippin RpTNF gene recombinant protein, its preparation and application

The invention, relating to genetic engineering, particularly relates to Ruditapes philippin RpTNF gene recombinant protein, its preparation and application. The RpTNF gene recombinant protein is shown as an amino acid sequence in SEQ ID No.1 in the sequence table. The preparation is characterized by amplifying Ruditapes philippin tumor necrosis factor RpTNF gene cDNA full length through PCR technique, and carrying out prokaryotic recombination expression on the TNF structure. According to the invention, the preparation has simple operation, the constructing process of the vector can be completed with need of routine connection, conversion and sequencing and screening; the obtained recombinant protein has obvious activity characteristics, e.g. the RpTNF protein disclosed herein is the first sea invertebrate cytokine having biological activity.
Owner:INST OF OCEANOLOGY - CHINESE ACAD OF SCI

Balanced salt solution of marine invertebrate blood cells

The invention discloses a balanced salt solution of marine invertebrate blood cells. The balanced salt solution is prepared by the following steps: 1) dissolving 10-15 mM of KCl, 400-500 mM of NaCl, 20-23 mM of Na2HPO4, 10-13 mM of HEPES, 500-700 U / ml of penicillin, 400-600 [mu] g / [mu] l of streptomycin and 2-4 [mu] g / ml of nystatin in each liter of deionized water; and 2) adjusting the pH value of the solution obtained in the step 1) to 7.0-7.5, and filtering and sterilizing with a 0.22 [mu] m filter membrane to obtain the balanced salt solution. The method is suitable for most marine invertebrate blood cells, the damage degree to the blood cells is small, the cell activity is high, and the marine invertebrate blood cells can be protected from cracking when stored in an isotonic solution.
Owner:BEIBU GULF UNIV

Extraction Of Gelatin

A process for extracting gelatin from a marine invertebrate, comprising the steps of: 1) pre-treating a collagen-containing portion of the marine invertebrate with an alkali; and 2) extracting gelatin from the pre-treated collagen-containing portion with a weak acid solution at a temperature sufficient for conversion of collagen to gelatin to be effected.
Owner:NORIKA HLDG

Extraction process for a pharmaceutical product

A process for isolating a soluble, native collagen from a marine invertebrate, comprising the steps of: 1) treating a collagen-containing portion of the marine invertebrate with a weak acid solution in order to solubilise native collagen fibrils; 2) centrifuging the resultant slurry to remove tissue particulates; 3) adjusting the pH of the supernatant in order to precipitate collagen by addition of a base; 4) collecting the precipitated collagen; 5) resuspending the precipitated collagen; and performing buffer exchange against water using an 15 ultrafiltration membrane.
Owner:NORIKA HLDG

Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism

An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows:GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its fragments and a polypeptide, as well as transformed host organisms capable of producing the peptide such as microorganisms, animal cells, digital cells and plants, and an anti-microbial composition containing the peptide.
Owner:CENT NAT DE LA RECHERCHE SCI +1

Marine invertebrate cell culture method

The invention discloses a marine invertebrate cell culture method. The method comprises: (1) dissecting a marine invertebrate, collecting a marine invertebrate tissue sample and cleaning and disinfecting the tissue sample, (2) placing the cleaned and disinfected tissue sample in a primary medium and carrying out enzymatic digestion to obtain a primary cell suspension, (3) dispersing the primary cell suspension into a secondary medium and carrying out pre-culture, (4) replacing the secondary medium with a tertiary medium and carrying out post-culture, and (5) when the primary cell density is 60%, collecting the post-cultured cells, diluting the cells, transferring the cells into the tertiary medium and carrying out subculture. The different culture media in different culture stages of marine invertebrate cells adapt to the different culture requirements of marine invertebrate cells in different culture stages. The method can culture marine invertebrate cells with good viability for a long time and has the characteristics of quick and easy operation, stability and easy repeatability.
Owner:ZHEJIANG OCEAN UNIV

Ocean element electrolysis concentrated product and manufacture method thereof

The invention discloses an ocean element electrolysis concentrated product and a manufacture method thereof. The manufacture method comprises the following steps of: mixing a mineral powder component prepared from shells of marine invertebrates with a seawater component in a preset proportion to form a mixed liquid; and electrolyzing the mixed liquid to form an electrolytic concentrated liquid with preset components and pH value being larger than 7. By using an electrolysis processing method, the pH value and various mineral substances in the electrolytic concentrated liquid can be controlled, and residual chlorine in the mixed liquid, which is possibly harmful to the human body, can be effectively removed, therefore, the ocean element electrolysis concentrated product which has safer andrelatively stable quality and is suitable for varied applications.
Owner:冼柳冰
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products