Ruditapes philippin RpTNF gene recombinant protein, its preparation and application
A Philippine clam and gene recombination technology, applied in the field of genetic engineering, can solve problems such as lack of TNF information, and achieve the effects of obvious activity characteristics, wide application range and simple operation
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
experiment example 1
[0020] The RpTNF gene recombinant protein of clam philippines is shown in the amino acid sequence of SEQ ID NO.1 in the sequence table.
[0021] SEQ ID NO.1
[0022] MDKKLKNISMFVLLLVVVCLMAVLALVWSMPDIPKTVKTSELCLPSEIGLLKCGSTVDLLHDYL
[0023] EREIATKYDEVKRQNQKKQENHLKEVSARLMNIYDKSFWEMKPAAKLTGKEQPDLRKTDSNADM
[0024] VPIREWRNGRELYDTKGFIRYGIRYRNGRLVVPVDGTYFIYSNIDFFESCNPSSGLPDIKDINK
[0025] PIKHGIFKFNILEGEENELVSNVQPHTISTNRYYNSYSSYVSSLAELKAGDELSVKVSNITYIR
[0026] YTRDNYFGVNLI
[0027] (a) Sequence features:
[0028] ●Length: 268 amino acids
[0029] ●Type: protein
[0030] ●Chain type: double chain
[0031] (b) Molecular type: double-stranded DNA
[0032] (c) Assumption: No
[0033] (d) Antisense: no
[0034] (e) Original source: Philippine clams
[0035] (f) Specific name: PRT
[0036] Construction of RpTNF gene recombinant protein of clam philippines:
[0037] 1. Construction of the recombinant vector: The recombinant vector used in the present invention is the pET21a...
example 2
[0050] Anti-tumor Growth Activity Analysis of Recombinant Proteins
[0051] Taking tumor cell 7402 as the target cell, the killing effect of the RpTNF protein obtained in Example 1 on tumor cells was detected. Adjust tumor cell concentration to 1-5 x 10 5 / ml, take a 96-well plate and add 100ul cell suspension to each well, place at 37°C, 5% CO 2 Incubate overnight in an incubator under saturated humidity conditions; on the second day, different concentrations of recombinant proteins were added to the cell culture medium in advance, and 6 replicate wells were set up in each group, and a cell control group (without any addition) and a blank well (only added) were set up. culture medium); put the culture plate into a CO2 incubator, and cultivate for 72 hours at 37°C, 5% CO2 and saturated humidity; add 10ul of MTT solution (5mg / ml) to each well, and continue to cultivate for 4h at 37°C, protected from light; Terminate the culture, carefully discard the culture supernatant in th...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com