Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

35 results about "Cardiac myosin" patented technology

Cardiac myosin is the major antigen in the myocardium. Using affinity-purified anti-myosin antibodies, Cunningham et al. 64 identified an epitope of the N-terminal M5 and M6 proteins consisting of a five-amino acid residue (Gln-Lys-Ser-Lys-Gln) that cross-reacted with cardiac myosin.

Substituted urea derivatives for treating cardiac diseases

Certain substituted urea derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, and are useful in the treatment of systolic heart failure including congestive heart failure.
Owner:CYTOKINETICS INC

Nanometer gold cage compound, and applications thereof in preparation of kit used for detecting cMyBP-C in human urine or blood

The invention discloses a nanometer gold cage compound, and applications thereof in preparation of a kit used for detecting cMyBP-C in human urine or blood. The nanometer gold cage compound is capableof realizing covalent boding with a pair of anti-human cardiac myosin C monoclonal antibody BT09 and BT10, and forming the kit used for rapid detection of cMyBP-C in human urine or blood. The nanometer gold cage compound is used for replacing conventional spherical nanometer particles commonly used in colloidal gold test strips, is extremely high in human blood and/or urea cMyBP-C detection sensitivity and specificity; distinguishing light signals better that those of the spherical nanometer particles are generated based on the white background. At specific application conditions (size and diameter), the cube hollow nanometer crystal is capable of realizing covalent bond combination with DNA and proteins, biotin labelled single chain DNA is capable of connecting nanometer antibodies of two sizes, the detection signal is increased by 5000 to 10000 times of that of colloidal gold nanometer sphere POCT product. It is observed in results that the sensitivity is as high as 100fg/mL, reading of results is realized in 15min, and excellent stability and repeatability are achieved.
Owner:南京博天科智生物技术有限公司

Quantitative determination method of cardiac myosin binding protein C and detection kit

The invention discloses a quantitative determination method of cardiac myosin binding protein C. According to the method, firstly, antibody coupling super paramagnetic micro particles and samples to be tested take specific combination reaction to obtain a first reactant, wherein the antibody coupling super paramagnetic micro particles are products obtained by coupling super paramagnetic micro particles and anti-cMyBP-C monoclonal antibodies A; then, the first reactant is taken to perform specific combination reaction with enzyme-labeled articles to obtain a second reactant, wherein the enzyme-labeled articles are products obtained by coupling enzymes and anti-cMyBP-C monoclonal antibodies B; finally, chemiluminescence substrates and the second reactant are taken to take enzymatic reaction;luminous signals are determined; the concentration value of cMyBP-C is obtained. The technology mode of the invention is a sandwich method. Compared with a cMyBP-C ELISA kit, the detection method andthe prepared kit have the advantages that the detection sensitivity and the linear range can be greatly improved. The technology evaluation on the prepared kit shows that the analysis sensitivity is0.05 ng/ml; the detection range is 0.1 to 50 ng/ml; high correlation and coincidence rate to clinic AMI patients are high.
Owner:AUTOBIO DIAGNOSTICS CO LTD

Myosin Derived Peptides and Related Compounds with Anticoagulant Activities

The present invention provides myosin derived peptides, variants and derivative compounds that are anti-coagulant. Also provided in the invention are antibodies that specifically target the peptides or epitopes presented thereon. Further provided in the invention are methods directed to using the anti-coagulant compounds described herein in therapeutic applications, e.g., inhibiting myosin-supported prothrombin activation to reduce the risk of acute trauma coagulopathy in post-trauma patients or inhibiting cardiac myosin-supported prothrombin activation to reduce the risk of coronary thrombosis.
Owner:THE SCRIPPS RES INST +1

Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions

InactiveUS20060088544A1Effectively eliminate subsetDecrease and eliminate adverse effectPeptide/protein ingredientsDepsipeptidesCardiac myosinDisease
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
Owner:CEL SCI CORP
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products