Gene regulatory peptides
a technology of gene regulation and peptides, applied in the field of biotechnology, can solve the problems of slow progress in determining exactly how to achieve nuclear transcriptional activation of a specific and limited set of genes, and it is difficult to use peptides in experiments
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
examples
Materials and Methods
Peptide Synthesis
[0188] The peptides as mentioned in this document, such as LQG (SEQ ID NO:29), AQG (SEQ ID NO:30), LQGV (SEQ ID NO:6), AQGV (SEQ ID NO:12), LQGA (SEQ ID NO:31), VLPALP (SEQ ID NO:10), ALPALP (SEQ ID NO:33), VAPALP (SEQ ID NO:34), ALPALPQ (SEQ ID NO:35), VLPAAPQ (SEQ ID NO:36), VLPALAQ (SEQ ID NO:37), LAGV (SEQ ID NO:38), VLAALP (SEQ ID NO:39), VLPALA (SEQ ID NO:40), VLPALPQ (SEQ ID NO:41), VLAALPQ (SEQ ID NO:42), VLPALPA (SEQ ID NO:43), GVLPALP (SEQ ID NO:44), VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCAL (SEQ ID NO:47), RPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT (SEQ ID NO:59), SKAPPPSLPSPSRLPGPS (SEQ ID NO:50), LQGVLPALPQVVC (SEQ ID NO:46), SIRLPGCPRGVNPVVS (SEQ ID NO:51), LPGCPRGVNPVVS (SEQ ID NO:52), LPGC (SEQ ID NO:53), MTRV (SEQ ID NO:54), MTR (SEQ ID NO:55), and VVC (SEQ ID NO:56), were prepared by solid-phase synthesis (Merrifield, 1963) using the fluorenylnethoxycarbonyl (Fmoc) / tert-butyl-based methodology (Atherton, 1985) with 2-chlorotrityl chlo...
PUM
Property | Measurement | Unit |
---|---|---|
Permeability | aaaaa | aaaaa |
Gene expression profile | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap