Giant panda lutropin beta subunit monoclonal antibody preparation method and application thereof
A monoclonal antibody, β subunit technology, applied in the biological field, can solve the problem of no specific anti-giant panda LH specific antibody and so on
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0024] The preparation method of specific anti-giant panda LHβ monoclonal antibody has the following steps:
[0025] 1) Design and synthesis of specific polypeptide fragments: According to the giant panda LHβ subunit protein sequence (NP_001291788.1), referring to the sequence analysis of other species, the giant panda LHβ subunit-specific sequence SEQ ID NO: 1 was designed: CGGPRAQPLACDRPPLPGLL, This specific polypeptide fragment is artificially synthesized and coupled with KLH to enhance the immunogenicity as the immunogen (LHβ-KLH) for the production of specific antibodies. This part is entrusted to Shanghai Sangon Biotechnology Co., Ltd. to complete.
[0026] 2) Mice immunization: Adjuvant: antigen = 1:1 (coupling polypeptide LHβ-KLH) mixed solution, after complete emulsification, intraperitoneal injection. The adjuvant for the first immunization is complete adjuvant, and the adjuvant for the subsequent immunization is incomplete adjuvant. Before the first immunization of ...
Embodiment 1
[0035] 1. Preparation of anti-giant panda LHβ monoclonal antibody
[0036] 1.1 Design and synthesis of specific polypeptide fragments: According to the amino acid sequence of the giant panda LHβ subunit in the NCBI database, accession number: NP_001291788.1, the sequence is: MEMFQGLLLWLLLNTGGAWASRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELRFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLFNSDCGGPRAQPLACDRPPLPPG
[0037] L, and referring to the sequence analysis of other species, the giant panda LHβ-specific sequence CGGPRAQPLACDRPPLPGLL (LHβ-1) was designed, artificially synthesized, and coupled with KLH (key empty hemocyanin), as an immunogen for the production of specific antibodies ( LHβ-KLH). For the synthesis of polypeptide fragments, this process is relatively mature. Through the sequence disclosed in this application, Sangon Bioengineering (Shanghai) Co., Ltd. can produce polypeptide fragment LHβ-1 and immunogen LHβ-KLH
[0038] 1.2 Immunization of mice with antigen: i...
Embodiment 2
[0093] Application of anti-giant panda LHβ subunit monoclonal antibody in western blot technique.
[0094] Extraction of total protein from target tissue
[0095] Application of protein extraction kit: C510004-0020, provided by Sangon Bioengineering (Shanghai) Co., Ltd., to extract total protein from adult giant panda pituitary tissue, and determine the total protein concentration by BCA method.
[0096] 2 Gel preparation: prepare polyacrylamide gel, stacking gel 5%, separating gel 12%.
[0097] 4. Sample preparation: protein sample volume is 80ug
[0098] 5. Electrophoresis: stacking gel 80V, 30min; separating gel 120V, 90min.
[0099] 6. Film transfer: 250mA, 40min.
[0100] 7. Sealing: 5% skimmed milk, shake slowly at 37°C for 2 hours.
[0101] 8. Incubate the primary antibody: the antibodies of hybridoma cell line 14081-1-9(2) and C12(3) were diluted 1:500, shake slowly at 4°C overnight, and rewarm at 37°C for 1 hour the next day.
[0102] 9. Incubate the secondary an...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com