Preparation and applications of giant panda follicle-stimulating hormone beta subunit monoclonal antibody
A monoclonal antibody and β subunit technology, applied in the field of monoclonal antibody preparation, can solve the problem of no specific anti-giant panda FSH specific antibody
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0019] The preparation method of specific anti-giant panda FSHβ monoclonal antibody has the following steps:
[0020] 1) Design and synthesis of specific polypeptide fragments: According to the protein sequence of the giant panda FSH β subunit (NP_001291794), referring to the sequence analysis of other species, a specific sequence of the giant panda FSH β subunit was designed, as shown in SEQ ID NO: 1: LVYKDPARPNIQKICTFKELAYETVKVPGC, artificially synthesized This specific polypeptide fragment is coupled with KLH to enhance the immunogenicity as an immunogen (FSHβ-KLH) for the production of specific antibodies. This part is entrusted to Shanghai Sangon Biotechnology Co., Ltd. to complete.
[0021] 2) Immunization of mice: Adjuvant: antigen = 1:1 (coupling polypeptide FSHβ-KLH) mixed solution, after complete emulsification, intraperitoneal injection. The adjuvant for the first immunization is complete adjuvant, and the adjuvant for the subsequent immunization is incomplete adjuv...
Embodiment 1
[0030] 1. Preparation of anti-Panda FSHβ monoclonal antibody
[0031] 1.1 Design and synthesis of specific polypeptide fragments: According to the NCBI database giant panda FSHβ subunit amino acid sequence, accession number: NP_001291794, the sequence is:
[0032] MKSVQLCFLFCCWRAICCKSCELTNITITVEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKICTFKELAYETVKVPGCAHQADSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFNEMKE, and referring to the sequence analysis of other species, designed a giant panda FSHβ-specific sequence
[0033] LVYKDPARPNIQKICTFKELAYETVKVPGC (FSHβ-1) is artificially synthesized and coupled with KLH (spoon space hemocyanin) to produce specific antibody immunogen (FSHβ-KLH). For the synthesis of polypeptide fragments, this process is relatively mature. Through the sequence disclosed in this application, Sangon Bioengineering (Shanghai) Co., Ltd. can produce polypeptide fragment FSHβ-1 and immunogen FSHβ-KLH
[0034] 1.2 Immunization of mice with antigen: inoculate with a mixture of adju...
Embodiment 2
[0089] Application of anti-giant panda FSHβ subunit monoclonal antibody in western blot technique.
[0090] 1. Extraction of total protein from the target tissue
[0091] Application of protein extraction kit: C510004-0020, provided by Sangon Bioengineering (Shanghai) Co., Ltd., to extract total protein from adult giant panda testis and ovary tissue, and determine the total protein concentration by BCA method.
[0092] 2 Gel preparation: prepare polyacrylamide gel, stacking gel 5%, separating gel 12%.
[0093] 4. Sample preparation: protein sample volume is 80ug
[0094] 5. Electrophoresis: stacking gel 80V, 30min; separating gel 120V, 90min.
[0095] 6. Film transfer: 250mA, 40min.
[0096] 7. Sealing: 5% skimmed milk, shake slowly at 37°C for 2 hours.
[0097] 8. Incubate the primary antibody: Dilute hybridoma cell line 09199(2) and C12(3) antibodies at 1:500, shake slowly at 4°C overnight, and rewarm at 37°C for 1 hour the next day.
[0098] 9. Incubate the secondary a...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com