TEM-1 targeted gene vaccine and construction and application thereof
A gene vaccine and targeting technology, applied in the field of targeting TEM-1 gene vaccine and its construction and application, can solve the problems of weak immunogenicity and achieve the effect of simple steps, small adverse reactions and wide range of effects
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0074] This embodiment provides a gene vaccine targeting TEM-1. The gene vaccine uses flagellin (SF) as an adjuvant and uses the rTEM-1 gene as an antigen to obtain the rTEM-1-SF fusion gene;
[0075] The rTEM-1 is obtained by screening the dominant epitope gene sequence rTEM-1 of T lymphocytes and B cells from the TEM-1 gene and then synthesizing the artificial rTEM-1 gene fragment by PCR;
[0076] The amino acid sequence of the rTEM-1 gene is as follows:
[0077] DLSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPH RCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSP AGAMGAQASQDLRDELLDDGEEGEDEEEPWEDFDGTWTEEQGI LWLAPTHPPDFGLPYRPNFPQDGEPQRLHLEPTWPPPLSAPRGPY HSSVVSATRPMVISATRPTLPSAHKTSVISATRPPLSPVHPPAMAPA TPPAVFSEHQIPKIKANYPDLPFGHKPGITSATHPARSPPYQPPIIST NYPQVFPPHQAPMSPDTHTITYLPPVPPHLDPGDTTSKAHQHPLL PDAPGIRTQAPQLSVSALQPPLPTNSRSSVHETPVPAANQPPAFPS SPLPPQRPTNQTSSISPTHSYSRAPLVPREGVPSPKSVPQLPSVPST AAPTALAESGLAGQSQRDDRWLLVALLVPTCVFLVVLLALGIVY CTRCGSHAPNKRITDCYRWVTHAGNKSSTEPMPPRGSLTGVQTC RTSV
[0078] Th...
Embodiment 2
[0084] The construction method of the targeted TEM-1 gene vaccine comprises the steps of:
[0085] (1) Obtain rTEM-1-SF fusion gene
[0086] According to the full-length DNA sequence of TEM-1 registered in GenBank, the DNA Star bioinformatics software was used to analyze T lymphocyte and B cell epitopes, intercept the extracellular expression sequence and screen the dominant epitope gene sequence rTEM of T lymphocytes and B cells -1, synthesize artificial rTEM-1 gene fragments by PCR, and use flagellin protein as an adjuvant to obtain rTEM-1-SF fusion gene;
[0087] (2) enzyme-cut connection of vector and rTEM-1-SF fusion gene
[0088] Digest the rTEM-1-SF fusion gene and vector with NheI and XhoI, and then use T4 DNA ligase to connect the recovered rTEM-1-SF fusion gene fragment and vector digestion fragment to obtain the ligation product;
[0089] (3) Conversion of ligation products
[0090] Take the ligation product and Escherichia coli competent cells and add them to EP...
Embodiment 3
[0110] This example explores the application of a gene vaccine targeting TEM-1 in the prevention and treatment of breast cancer; the specific operations are as follows:
[0111] 1. Preparation of targeted TEM-1 gene vaccine
[0112] 1.1 Acquisition of rTEM-1-SF fusion gene
[0113] According to the full-length DNA sequence of TEM-1 registered in GenBank, the DNA Star bioinformatics software was used to analyze T lymphocyte and B cell epitopes, intercept the extracellular expression sequence and screen the dominant epitope gene sequence rTEM of T lymphocytes and B cells -1, synthesize artificial rTEM-1 gene fragments by PCR, and use flagellin protein as an adjuvant to obtain rTEM-1-SF fusion gene;
[0114] 1.2 Restriction ligation of vector and rTEM-1-SF fusion gene
[0115] The rTEM-1-SF fusion gene and pcDNA3.1 (Amp) vector were digested with NheI and XhoI, and then the recovered rTEM-1-SF fusion gene fragment and vector digestion fragment were ligated with T4 DNA ligase to...
PUM
Property | Measurement | Unit |
---|---|---|
molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com