Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Novel Edwardsiella attenuated target and application thereof

An attenuated strain and application technology, applied in the identification and application of Edwardsiella attenuated targets, can solve the problems of a large number of drug-resistant pathogens and environmental pollution

Active Publication Date: 2020-08-04
EAST CHINA UNIV OF SCI & TECH
View PDF3 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, the environmental pollution caused by this disease control measure, the emergence of a large number of drug-resistant pathogens, and the negative impact of drug residues in aquatic products are becoming more and more serious.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Novel Edwardsiella attenuated target and application thereof
  • Novel Edwardsiella attenuated target and application thereof
  • Novel Edwardsiella attenuated target and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0110] Example 1. Construction of unmarked in-frame deletion strain

[0111] The gene sequence (SEQ ID NO:1) of ETAE_0023 is:

[0112] atgggtaatttagtgaagttgatcggcgtcgggctgttggttaccggactggccgcctgcgatggcagctccaccgcggagaccaacgcaccggcgcagggtgcgagcgcgactcagcccagcgtgccggcgggtgccaaagtcagcctgttagacggtaagattggctttacgctgcctgcgggactgagcgatcagaccagcaagctgggctcacagaccaacaatatgtccgtgtatgccaataaaaccgggcagcaggcggtgatcgtcatcttggcgccgatgccgcaggataacctgaataccctgtcgacccgcctgattgaccagcagaaatcacgcgacgccagcctgcagctggtctcgtctgagagcgttaagctgggtggaaaggacgttgagaaggtcgtgagtatgcagcaggcgaacggtcacgccatctactccagcattatcttagcccaggtcggcgatcagctgatgaccatgcagatctccctgccgggcgataatcgccaagaagcggccaatatcgccaacggcgtgctcaataccctctcctttgcccaataa

[0113] The amino acid sequence (SEQ ID NO: 2) (191aa) of ETAE_0023 is:

[0114] MGNLVKLIGVGLLVTGLAACDGSSTAETNAPAQGASATQPSVPAGAKVSLLDGKIGFTLPAGLSDQTSKLGSQTNNMSVYANKTGQQAVIVILAPMPQDNLNTLSTRLIDQQKSRDASLQLVSSESVKLGGKDVEKVVSMQQANGHAIGDQANILAQVNNRQLMQISQQANGHAIYSSIILAQVNNRQLMQISQQTLS

[0115]...

Embodiment 2

[0128] Example 2. Immunogenicity test

[0129] The reported live attenuated vaccine strains WED and ΔaroC were selected as positive controls, and PBS and FKC were used as negative controls. The vaccine strains ΔETAE_0023, WED and ΔaroC were selected as 3×10 5 The dose of CFU / tail was injected intraperitoneally into the fish for vaccination. At 28 days after immunization, 5 fishes immunized with each strain were taken for experiment. Use a disposable syringe to draw peripheral blood from the tail vein, put it into a 1.5ml sterile EP tube, place it at 4°C for 1 hour, centrifuge at 4000g, 4°C for 5 minutes, and take out the serum to test the serum's bactericidal ability ( figure 2 A). At the same time, take turbot immune organ head kidney and place it in tissue preservation solution to extract tissue RNA and detect the expression level of immune factors such as IL-1β, IgM, MHC-I and MHC-II ( figure 2 B), to determine whether the vaccine strain can effectively activate the host imm...

Embodiment 3

[0131] Example 3. Half-lethal dose of vaccine strain LD 50

[0132] Measure the LD of wild strain, WED, ΔaroC and attenuated live vaccine strain EIBVA0023 (ΔETAE_0023) respectively 50 .

[0133] The half-lethal dose LD of Edwardsi piscicida wild strain and live vaccine strain to turbot 50 As shown in Table 1.

[0134] Table 1

[0135]

[0136]

[0137] The results showed that the virulence of the EIBVA0023 candidate live vaccine strain was lower than that of the wild E. piscicida strain EIB202, and could achieve the reported attenuation effect of the live attenuated vaccine strain WED. The attenuation effect is very obvious and meets the requirements of the vaccine strain.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a novel Edwardsiella attenuated target and application thereof. The gene ETAE-0023 related to the toxicity of the Edwardsiella is identified and obtained in the Edwardsiella for the first time. The invention also discloses an Edwardsiella attenuated strain and an attenuated vaccine which are developed by taking the gene as a target, and the Edwardsiella attenuated strain and the attenuated vaccine have remarkable immunogenicity, high in-vivo clearance rate and very ideal safety and immune response effect.

Description

Technical field [0001] The present invention belongs to the field of research and development of live attenuated vaccines; more specifically, the present invention relates to the identification and application of a new attenuated target of Edwardsiella. Background technique [0002] With the improvement of people's living standards, people's demand for seafood is increasing, and China's aquaculture industry has increased its catch ratio year by year. According to statistics, in 2016, China's aquaculture area reached 8,346 thousand hectares, and the total amount of aquaculture products was 51.42 million tons. The aquaculture output accounted for 75% of the total fishery output and about 60% of the world's total aquaculture output. Large-scale, intensive, and high-density breeding models have gradually become the mainstream of the development of China's fish breeding industry. However, with the continuous and steady development of fish farming, the potential problem that arises is...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C12N1/21C12Q1/689C12Q1/04A61K39/02A61P31/04G01N33/569C12R1/01
CPCC07K14/195C12Q1/689A61K39/0208A61P31/04G01N33/56911C12Q2600/158Y02A40/81
Inventor 王启要马瑞青张元兴刘琴
Owner EAST CHINA UNIV OF SCI & TECH
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More