Edwardsiella tarda outer membrane protein vaccine and its preparation and application
A technology for Edwards tarda and outer membrane protein, which is applied in the field of Edwardian tarda outer membrane protein vaccine and its preparation, can solve problems such as not yet applied on a large scale, and achieve the effect of promoting immune activity
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0026] The E. lentus outer membrane protein vaccine antigen is shown in the amino acid sequence in SEQ ID No. 1 of the sequence table, and the amino acid sequence is a sequence on the E. Sequence, the base sequence except the signal peptide part was obtained by gene synthesis as the antigen sequence (synthesis was completed by Sangon Bioengineering Co., Ltd. (Shanghai)), and the translated amino acid sequence was as follows.
[0027] SEQ ID No. 1:
[0028] MSSGDSTITLNYIQQSNGQVEKDLAGFKQITDQFIGSEHFGASTAPYRDAEGVALSYRYEFTDCWGVIGRLSYTGLRRGMQIRRGHNYGPGVPLVLVDGRSRSQRWGIMAGPSYRVTDNLSLYGLAGASVDRLSWHIQVDDGANDVLGTALHTADQQLTRVSMAYAAGVQLNAGGYVLDFSYTGVGGDDRSHGFLVGVGLIF
[0029] (a) Sequence features:
[0030] Length: 201
[0031] Type: amino acid sequence
[0032] ·Chain type: single chain
[0033] Topology: Linear
[0034] (b) Molecular type: protein
[0035] (c) Assumption: No
[0036] (d) Antonym: No
[0037] (e) Original source: Edwardsiella lentus TX1
[0038] (f) Specificity ...
Embodiment 2
[0041] Construction method of Edwardsiella lentus vaccine expression vector
[0042] Construction of the recombinant plasmid pETOmp1: The antigenic base sequence of the Edwardella lentus outer membrane protein vaccine synthesized by the above-mentioned Sangon Bioengineering Co., Ltd. (Shanghai) was used as a template, and it was connected to the commercial plasmid pET28a by homologous recombination. , the recombinant plasmid pETOmp1 was obtained. The LB liquid medium is used for culturing Escherichia coli, and the components are in percentage by weight: 1.0% peptone, 0.5% yeast powder, 1.0% sodium chloride, 97.5% distilled water;
Embodiment example 3
[0044] Inducible expression and purification of vaccine proteins
[0045] Vaccine protein rOmp1 Et Inducible expression and purification: The plasmid pETOmp1 was transformed into Escherichia coli BL21(DE3) (Beijing, Quanshijin Biotechnology Co., Ltd.), and the bacterial solution was cultured on LB solid medium containing kanamycin (50 μg / ml) After 18-24 hours, a positive clone BL21 / pETOmp1 was screened and obtained. BL21 / pETOmp1 was cultured overnight in LB liquid medium containing kanamycin (50 μg / ml). Take 5ml of the bacterial liquid after overnight culture, add it to 500ml of fresh LB liquid medium containing kanamycin (50μg / ml), shake and cultivate to OD at 37°C in a shaker with a rotating speed of 180rpm. 600 After ≈0.5, IPTG was added at a final concentration of 1 mM, and the culture was continued for 16 hours with shaking at 16°C and 180 rpm. Centrifuge at 6000g at 4°C for 10 minutes, and collect the bacterial cells cultured under the above conditions. Add 5 ml of l...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap