Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Preparation method of water-soluble Sargassum fusiforme polysaccharides

A technology for water-soluble polysaccharide and hijiki, applied in the field of polysaccharide extraction, can solve problems such as unfavorable polysaccharide extraction rate, unsatisfactory cell wall breaking, etc., achieve immunomodulatory biological function, shorten extraction time, improve yield and activity Effect

Inactive Publication Date: 2017-10-20
浦江县欧立生物技术有限公司
View PDF3 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In addition, the hijiki polysaccharide produced by this process adopts the combination of activated carbon adsorption and AB-8 macroporous adsorption resin for decolorization and decolorization, which solves the key technology of deodorization and decolorization of hijiki and other marine brown algae polysaccharides, and effectively improves Polysaccharide purity, appearance quality, and high antioxidant activity of polysaccharides after deodorization and decolorization are guaranteed, but the cell wall breaking is not ideal, which is not conducive to the extraction rate of polysaccharides

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0013] A method for preparing a water-soluble polysaccharide from hijiki, comprising: ultrasonic leaching of the polysaccharide, protein removal, alcohol precipitation and drying, and the specific operation steps are:

[0014] (1) The steps of ultrasonic leaching of polysaccharides are: add hijiki coarse powder to 0.8% NaCl solution, which is 0.04% active polypeptide by weight of the coarse powder. The amino acid sequence of the active polypeptide is: MKGLSFVLLVLLLMPDGEGTDPEMQYWTCGYRGLCRFCAQYFVGHHGCPRRYRCCAIRA. Ultrasonic treatment after mixing, the temperature of ultrasonic treatment is 4°C, the time is 2.5h, placed at 3°C ​​for 6h, and the filtrate is centrifuged at 4°C at 7000rpm for 20min, and the supernatant is obtained to obtain a crude protein solution. The peptide is hydrophilic and lipophilic. The hydrophilicity makes it soluble in distilled water, and the lipophilicity makes it combine with the cell membrane of Spirulina, forming small holes under the cell membrane, r...

Embodiment 2

[0018] A method for preparing a water-soluble polysaccharide from hijiki, comprising: ultrasonic leaching of the polysaccharide, protein removal, alcohol precipitation and drying, and the specific operation steps are:

[0019] (1) The steps of ultrasonic leaching of polysaccharides are: add hijiki coarse powder to 1% NaCl solution to obtain 0.04% active polypeptide by weight of the coarse powder. The amino acid sequence of the active polypeptide is: MKGLSFVLLVLLLMPDGEGTDPEMQYWTCGYRGLCRFCAQYFVGHHGCPRRYRCCAIRA. Ultrasonic treatment after mixing, the temperature of ultrasonic treatment is 3°C, the time is 3h, placed in 5°C for suction filtration for 8h, the filtrate is centrifuged at 5°C at 6000rpm for 20min, the supernatant is taken to obtain a crude protein solution, the active peptide It is hydrophilic and lipophilic. The hydrophilicity makes it soluble in distilled water. The lipophilicity makes it combine with the cell membrane of Spirulina, forming small holes under the cell...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a preparation method of water-soluble Sargassum fusiforme polysaccharides. The method comprises the following steps: ultrasonic extraction of the polysaccharides, deproteinization, and alcohol precipitation and drying; and the ultrasonic extraction step of the polysaccharides comprises: adding a NaCl solution and active polypeptides to Sargassum fusiforme meal, uniformly mixing the NaCl solution, the active polypeptides and the Sargassum fusiforme meal, carrying out suction filtration, centrifuging the obtained suction filtration liquid, and taking the obtained supernatant to obtain crude protein liquid. The method adopting the ultrasonic extraction of the Sargassum fusiforme and breaking cells by using the active peptides, the low salt solution, a swelling technology and an ultrasonic technology has the advantages of great shortening of the extraction time, good extraction effect, high content of proteins in the crude protein liquid and facilitation of the yield and the activity of the polysaccharides; and the water-soluble Sargassum fusiforme polysaccharides obtained by the extraction method have excellent anti-oxidation, anticoagulation, anti-inflammation, anticancer, antitumor and immune regulation functions and other biological functions.

Description

technical field [0001] The invention relates to the technical field of polysaccharide extraction, in particular to a preparation method of hijiki water-soluble polysaccharide. Background technique [0002] Sargassum fusiforme polysaccharides (SFPS) is a water-soluble polysaccharide extracted from whole algae, including alginic acid, fucoidan (FCD) and laminaran. The acid is mainly D-mannuronic acid polymer combined with β-1, 4 bonds, which is relatively high in hijiki, accounting for 20.8%. Fucoidan sulfate is mainly composed of L-fucose and sulfate radicals , its content is less, generally between 0.5 and 10%. According to the consistency of monosaccharides, polysaccharides can be divided into homopolysaccharides and heteropolysaccharides. In recent years, many studies have shown that hijiki contains more Water-soluble sulfated polysaccharides from brown algae, and the biological activities of different species of sulfated polysaccharides from brown algae have been reporte...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C08B37/04
CPCC08B37/0084
Inventor 李冰
Owner 浦江县欧立生物技术有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com