Humanized antibody against epidermal growth factor receptor and application thereof
An epidermal growth factor and antibody technology, which is used in the preparation of drugs for the prevention or treatment of diseases related to epidermal growth factor high activity or high expression. Reduced biological activity, no obvious advantages, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0082] Example 1. Design of heavy chain variable region sequence of anti-surface epidermal growth factor receptor humanized monoclonal antibody
[0083] The following is the sequence of the heavy chain variable region of mouse anti-M225, the underlined parts are FR1, FR2, FR3 and FR4 framework sequences: QVQLKQSGPGLVQPSQSLSITCTVSGFSLT NYGVH WVRQSPGKGLEWL G VIWSGGNTDYNTPFTS RLSINKDNSKSQVFFKMNSLQSNDTAIYYCAR ALTYYDYEFAY WGQGTLVTVSA (SEQ ID NO: 17).
[0084] According to its heavy chain variable region FR1, FR2, FR3 and FR4 sequence, compare the human antibody gene sequence library to find the human germline (germline) similar to the mouse anti-M225 heavy chain variable region FR1, FR2, FR3 and FR4 sequence ) corresponding sequence of antibody variable region. Then use the NetMHCIIpan software or self-compiled software to analyze the binding affinity of similar sequences to HLA-DR molecules through the in silicon method, and select the framework sequence with the lowest a...
Embodiment 2
[0104] Example 2. Design of light chain variable region sequence of anti-epidermal growth factor receptor humanized monoclonal antibody
[0105] The following is the sequence of the light chain variable region of mouse anti-M225, the underlined parts are FR1, FR2, FR3 and FR4 framework sequences:
[0106] DILLTQSPVILSVSPGERVSFSC RASQSIG TNIH WYQQRTNGSPRLLIK YASESIS GIPSRFSGSGSGTDFTLSINSVESEDIADYYC QQNNNWPTT FGAG TKLELK (SEQ ID NO: 18).
[0107]Also analyze the sequence of the light chain variable region of the mouse anti-225 antibody, compare the human antibody gene sequence library according to its light chain variable region FR1, FR2, FR3 and FR4 sequences, and find out the light chain variable region of the mouse anti-M225 antibody FR1, FR2, FR3 and FR4 sequences are similar to the human germline (germline) antibody variable region corresponding sequence, and then use NetMHCIIpan software or self-compiled software to analyze the binding affinity of the selected si...
Embodiment 3
[0125] Example 3, Preparation of anti-epidermal growth factor receptor humanized monoclonal antibody
[0126] (1) According to the antibody heavy chain variable region sequence and light chain variable region sequence determined in Examples 1 and 2, respectively design and synthesize PCR primer oligonucleotide fragments encoding heavy chain and light chain variable region sequences, synthesize Introduce the necessary enzyme cutting sites. PCR primer oligonucleotide fragments are generally about 54 bases in length, and adjacent oligonucleotide fragments overlap by about 18 bases. Mix equal amounts of each PCR primer fragment and perform overlap extension PCR reaction.
[0127] PCR reaction system: dNTPs 0.2 μM (final concentration); each PCR primer fragment 1 μl; 10×buffer 3 μl; cloned pfu (Invitrogen) 1 μl; add water to 30 μl.
[0128] PCR reaction conditions: 94°C for 3min→(94°C for 30s→56°C for 30s→72°C for 1min)×30→72°C for 10min
[0129] The PCR product was separated by...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com