Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Combination detection reagent for detecting schistosomiasis and detecting method thereof

A technology for combined detection and schistosomiasis, applied in biological testing, chemical instruments and methods, measuring devices, etc., can solve the problems of people's health and social and economic development losses in epidemic areas, serious epidemics of this disease, etc., and achieve low cost and sensitive detection Strong, easy to standardize the effect

Inactive Publication Date: 2005-11-23
ANHUI MEDICAL UNIV
View PDF0 Cites 9 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Over the past 50 years, although great achievements have been made in the prevention and control of schistosomiasis in my country, due to various social and economic reasons, the epidemic situation of this disease is still serious, causing huge losses to the health of the people in the affected areas and social and economic development.
But so far there is no method or detection system that can meet this standard

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment

[0038] The combined detection reagent for the detection of schistosomiasis is characterized in that it is composed of the following raw materials with the following concentration ratios:

[0039] Recombinant antigen mixture 0.2-0.4ug / well

[0040] Recombinant schistosome signal protein 14-3-3 monoclonal antibody (14-3-3mAb) 0.5-1ug / well,

[0041] The recombinant antigen mixture is:

[0042] A. Recombinant schistosome signal protein 14-3-3 (rSj14-3-3) 0.1-0.2ug / well

[0043] B. Recombinant Schistosoma glutathione-S-transferase (GST) 0.1-0.2ug / well

[0044] And A and B are mixed according to the protein concentration of 1:1;

[0045] Recombinant schistosome signal protein 14-3-3 (rSj14-3-3): protein, PI: 4.86; molecular weight: 29KD; containing 254 amino acids:

[0046] MRDSFVLQQKDLSPSDLVQIARLAEQAERYDDMAAAMKAYAELPAELGSEERNLFSVAYKNVVGARRSAWRVISAVEHKHDENSKKRQLTKEYRVKMEEELNEICREVLTLLSKYLTPKSNGFESQVFYRKMEGDYYRYLAEVATGDARKEVVEKSQAAYEKATEIAEEMLPSTHPIRLGLALNFSVFYYEIKCDPTQACNLAKRAFD...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
Molecular weightaaaaaaaaaa
Molecular weightaaaaaaaaaa
Login to View More

Abstract

The invention relates to a combined medium and method for testing snail fever. It has the following characters: the medium contains recombination antigen mixture and recombination snail signal protein (rSj14-3-3) monoclonal antibody, and recombination antigen is mixed as recombination snail signal protein (rSj14-3-3) and recombination snail glutathione-s-transferase (rSjGST). The test operation is separately according to indirect enzyme immunosorbent test and double antibody bedded texture method. The invention adopts the two advantage diagnosis antigen molecule and its corresponding monoclonal antigen to form combined testing medium box.

Description

technical field [0001] The invention relates to a combined detection reagent and a detection method for the detection of schistosomiasis. Background technique [0002] Schistosomiasis is a worldwide zoonotic parasitic disease, mainly prevalent in 74 tropical and subtropical countries and regions in Asia, Africa, and Latin America, with a threatened population of about 600 million and infected people of about 200 million. 20 million, the harm is serious. Schistosoma japonicum (S. japonicum), which is prevalent in my country, is the most harmful one. Over the past 50 years, although great achievements have been made in the prevention and control of schistosomiasis in my country, due to various social and economic reasons, the epidemic situation of this disease is still serious, causing huge losses to the health of the people in the affected areas and social and economic development. As of 1999, there were still 119 schistosomiasis-endemic counties and cities nationwide, with...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): G01N33/569
Inventor 沈继龙汪学龙葛继华沈光金
Owner ANHUI MEDICAL UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com