A kind of smcy sex-specific fusion antigen and its antibody and application
A recombinant antigen and polyclonal antibody technology, applied in the field of bioengineering, can solve the problem of time-consuming and labor-intensive methods for detecting gender by nucleic acid, and achieve the effect of significant technological progress.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0033] Example 1 SMCY Sequence Alignment and Analysis
[0034] like figure 1 As shown, the amino acid sequences of the three variants of SMCY and SMCX were queried and downloaded from NCBI, and SCMY (1539aa) was compared with SMCX variant 1 (1560aa), variant2 (1379aa), and variant 3 (1559aa) using sequence analysis software. Sequence alignment revealed three different fragments:
[0035] Fragment 1: 256-293aa (DKTVHKKVTCPPTVTVKDEQSGGGNVSSTLLKQHLSL);
[0036] Fragment 2: 814-845aa (RLKNCLSEVEACIAQVLGLVSGQVARMDTPQL);
[0037] Fragment 3: 1467-1560aa (QKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQNSLQHKDSGSSAACPSMPLLQLSYSDEQQL).
[0038] Using BIOSUN software to analyze the B cell epitope of the differential segment fusion antigen ( figure 2 ), the results showed that the fusion antigen still maintained the original B cell epitope and had good antigenicity.
Embodiment 2
[0039] The synthesis of embodiment 2 SMCY gene differential segment
[0040] According to the amino acid sequence of the three different fragments, the nucleic acid sequence is inversely deduced, codon optimization is performed, primers are designed according to the nucleic acid sequence, and then the synthetic primers are connected step by step through multiple rounds of PCR using the molecular biology bridging method to form A new SMCY gene recombinant encoding only these three fragments:
[0041] Composed of the amino acid sequences shown in SEQ ID NO.1, SEQ ID NO.2 and SEQ ID NO.3, there is no connecting fragment between the amino acid sequences shown in SEQ ID NO.1 and SEQ ID NO.2, so There is a connecting fragment between the amino acid sequences shown in EQ ID NO.2 and SEQ ID NO.3, and the connecting fragment is composed of two or three serines.
[0042] The homology to SMCX is significantly reduced, thereby greatly improving the male specificity of the SMCY sex-specif...
Embodiment 3
[0064] Example 3 Construction and expression of SMCY fusion antigen vector
[0065] Select the fusion segment antigen gene with a completely correct sequence and repeat it once, then digest it with BamH1 and EcoR1, recover the excised target fragment (about 516bp), and then connect it with the pET-28a vector that has been digested with BamH1 and EcoR1 with T4 Enzyme ligation to construct the recombinant expression plasmid pET-28a / SMCY ( image 3 , Figure 4 ). Then transform into Escherichia coli competent cells BL21(DE3), pick positive clone colonies, and inoculate LB culture medium containing kanamycin, after growing to the logarithmic phase, add IPTG, induce overnight at 37°C, and collect the bacterial liquid , SDS-PAGE electrophoresis to identify protein expression. The results showed that the SMCY sex-specific fusion antigen was expressed in the form of inclusion body, with a relative molecular weight of about 43KD ( Figure 5 ).
PUM

Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com