Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Antibacterial peptide

An antimicrobial peptide, GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM technology, applied in the direction of peptides, peptide sources, decapeptides, etc., can solve the problems of limited use, achieve a broad antibacterial spectrum and avoid strong hemolysis

Inactive Publication Date: 2014-03-19
HUZHOU TEACHERS COLLEGE
View PDF0 Cites 10 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] Melittin is the main active ingredient of Italian bee (Apismellifera) venom. It is an antibacterial peptide isolated from bee venom by Habermanm et al. It has antibacterial, anti-inflammatory, anti-radiation, anti-arthritis, anti-tumor, anti-AIDS And the effect on cardiovascular and other aspects, especially anti-Staphylococcus aureus, but melittin has a strong hemolytic property, which limits further clinical use

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antibacterial peptide
  • Antibacterial peptide
  • Antibacterial peptide

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0012] The primary structure of melittin: GIGAVLKVLTTGLPALISWIKRKRQQ, the primary structure of melittin: GSKKPVPIIYCNRRTGKCQRM, a new antibacterial peptide was designed: the N-terminus is amino acid 12-26 of melittin, and mutated into GLPLLISWIKRKRQQ9, amino acids in italics are mutant amino acids; C - The end is a complete death protein, and after the middle is connected with AGP, the primary structure of the designed antimicrobial peptide is GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM. (amino acid abbreviation rules: glycine G, serine S, alanine A, threonine T, valine V, isoleucine I, leucine L, tyrosine Y, phenylalanine F, histamine Acid H, Proline P, Aspartate D, Methionine M, Glutamate E, Tryptophan W, Lysine K, Cysteine ​​C, Arginine R)

[0013] (1) Construction of recombinant expression vector

[0014] See the build process figure 1 .

[0015] 1) Design primer five-segment primer:

[0016] Primer 1: 5-CTCGAGATGGGTCTTTCCTCTTCTTTATTTCTTGGATTAAGCGTAAGCGTCAACAAGCTGG

[0...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the technical field of drugs produced by gene engineering in the biotechnological pharmacy industry and in particular relates to an antibacterial peptide. A primary structure of the antibacterial peptide is CLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM. The newly designed antibacterial peptide simultaneously has the advantages of thanatin and melittin, not only has wide antibacterial spectrum but also can resist staphylococcus aureus and simultaneously avoids the disadvantage that melittin has strong hemolysis.

Description

technical field [0001] The invention belongs to the technical field of gene engineering medicine production in the biotechnology pharmaceutical industry, and is specifically an antibacterial peptide. Background technique [0002] Antibacterial peptides are a class of peptides with a small molecular weight, most of them are composed of 13-45 amino acids, some antibacterial peptides are all composed of L-amino acids, and some antibacterial peptide molecules contain both L-amino acids and D-amino acid, the molecular weight is generally several thousand Daltons, often positively charged, in 1980, Hultmark et al first isolated a cecropin from the pupa of Hyatophoracecropia, and named it cecropin. Antibacterial peptides have antibacterial, antiviral, antitumor and other activities, good water solubility, and high temperature resistance. Moreover, antimicrobial peptides are generally small peptides, which can be completely digested by animals, and there is no problem of residue. T...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/435C07K14/00
CPCC07K14/43563C07K14/43572C07K2319/00
Inventor 钱坤周国庆文良柱沈子龙葛海霞孙来玉肖莉张海洋徐秀芳
Owner HUZHOU TEACHERS COLLEGE
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com