Antibacterial peptide
An antimicrobial peptide, GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM technology, applied in the direction of peptides, peptide sources, decapeptides, etc., can solve the problems of limited use, achieve a broad antibacterial spectrum and avoid strong hemolysis
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0012] The primary structure of melittin: GIGAVLKVLTTGLPALISWIKRKRQQ, the primary structure of melittin: GSKKPVPIIYCNRRTGKCQRM, a new antibacterial peptide was designed: the N-terminus is amino acid 12-26 of melittin, and mutated into GLPLLISWIKRKRQQ9, amino acids in italics are mutant amino acids; C - The end is a complete death protein, and after the middle is connected with AGP, the primary structure of the designed antimicrobial peptide is GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM. (amino acid abbreviation rules: glycine G, serine S, alanine A, threonine T, valine V, isoleucine I, leucine L, tyrosine Y, phenylalanine F, histamine Acid H, Proline P, Aspartate D, Methionine M, Glutamate E, Tryptophan W, Lysine K, Cysteine C, Arginine R)
[0013] (1) Construction of recombinant expression vector
[0014] See the build process figure 1 .
[0015] 1) Design primer five-segment primer:
[0016] Primer 1: 5-CTCGAGATGGGTCTTTCCTCTTCTTTATTTCTTGGATTAAGCGTAAGCGTCAACAAGCTGG
[0...
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com