Thioredoxin and preparation method and application thereof
A technology of thioredoxin and sulfur oxide, which is applied in the field of molecular biology, can solve problems such as unclear functions and biological activities, and achieve obvious reductase activity and simple preparation
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0022] The thioredoxin of the present invention is the amino acid sequence in SEQ ID No.1 of the sequence table. The sequence listing SEQ ID No.1 is:
[0023] MVYEVKDYNDFTQQLKRAGNKLVVVDFTATWCQPCKNISPVFEELANQYKNVVFLKVDVDEADDVSTECE I NCMPTLFYRNEKRVHSFSGANSDTLRAAVKQYEKE
[0024] (a) Sequence features:
[0025] ·Length: 107
[0026] Type: amino acid sequence
[0027] Chain type: single chain
[0028] Topology: linear
[0029] (b) Molecule type: protein
[0030] (c) Assumption: No
[0031] (d) Antisense: no
[0032] (e) Original source: tongue sole
[0033] Structural features: The protein is expected to contain a CXXC domain consisting of amino acids 35-38,
Embodiment 2
[0035] The preparation method of thioredoxin:
[0036] 1) Construction of plasmid pETrx:
[0037] The cDNA of tongue sole was used as a template and PCR amplification was carried out with primers F1 and R1. The PCR conditions were: 94°C for 60s to pre-denature the template DNA, then 94°C for 40s, 48°C for 60s, 72°C for 60s, after 5 cycles, change to 94°C for 40s, 58°C for 60s, 72°C for 60s, and then repeat at 72°C after 30 cycles. ℃ extension reaction 7-10min. After the PCR product was purified, it was ligated with the carrier pBS-T (purchased from "Tiangen Biochemical Technology (Beijing) Co., Ltd.") at room temperature for 4-6 hours, and the ligation mixture was transformed into E. , Xgal (40ug / ml), and isopropyl-β-D-thiogalactoside (24ug / ml) were cultured on LB medium for 18-24 hours, and the transformants were screened to extract the plasmid, which was the plasmid pBSTrx. PBSTrx and plasmid pET259 (see Zheng, W.J., Hu, Y.H., Sun, L., 2010. Cloning and analysis of a ferr...
Embodiment 3
[0043] Thioredoxin reductase activity
[0044] Add the purified thioredoxin Trx to A buffer (0.1M PBS, 2mM DTT, 2mM EDTA-Na 2 , 1.25mg / ml insulin) to a final concentration of 4uM. An equal volume of PBS was added to the control group. Absorbance was measured at 650nm after incubation at 25°C for different times (A 650 ). The results showed that A in the control group 650 Almost zero, while A who joined the Trx group 650 The value is significantly strengthened with the extension of incubation time, indicating that thioredoxin has obvious reductase activity (see figure 2 ).
[0045] The composition of PBS is by weight percentage: 0.8% NaCl, 0.02% KCl, 0.358% Na 2 HPO 4 .12H 2 O, 0.024% NaH 2 PO 4 , and the balance is water.
PUM
Property | Measurement | Unit |
---|---|---|
molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com