Anti-CD3 and anti-CD19 bispecific antibody
A bispecific antibody and specific technology, which is applied in the field of anti-CD3 and anti-CD19 bispecific antibodies, can solve problems such as instability, short half-life of pharmacological molecules, mismatching of light and heavy chains, etc., to increase concentration and enhance killing ability , to avoid the effect of mismatch
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0038] The present invention constructs an anti-CD3 and anti-CD19 bispecific antibody molecule (the antibody is named JY039), which comprises a single-chain unit capable of specifically binding to the CD3 antigen and a monovalent unit capable of specifically binding to the CD19 antigen. Both the unit and the monovalent unit include a complete light chain and a complete heavy chain. The monovalent unit contains the light chain and heavy chain of the anti-CD19 antibody. The C-terminal of the light chain of the anti-CD3 antibody in the single-chain unit is connected to the N-terminal of the heavy chain through a linker Connection; the heavy chain includes the heavy chain variable region and the heavy chain constant region, and the light chain includes the light chain variable region and the light chain constant region. The specific configuration diagram is as follows figure 1 shown.
Embodiment 2
[0040] On the basis of Example 1, the present invention further defines a linker, the amino acid sequence of which is (GGGGX)n, wherein X is Gly or Ser, and n is a natural number of 1-6;
[0041] Preferably, X is Ser;
[0042] Preferably, n is 6.
[0043] Further, the amino acid sequence of the heavy chain variable region of the single chain unit is SEQ ID NO:1; the amino acid sequence of the light chain variable region of the single chain unit is SEQ ID NO:2;
[0044] Wherein, SEQ ID NO: 1 (the amino acid sequence of the heavy chain variable region of the single chain unit);
[0045] DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSS;
[0046] SEQ ID NO: 2 (amino acid sequence of the light chain variable region of the single chain unit);
[0047] DIQLTQSPAIMSASPGEKVTMTCRASSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK.
[0048] Further, the amino acid sequence of the heavy...
Embodiment 3
[0056] The present invention also provides a polypeptide or protein, both of which contain anti-CD3 and anti-CD19 bispecific antibodies.
[0057] The present invention also provides a nucleotide sequence or a combination thereof, and the nucleotide sequence or a combination thereof encodes the anti-CD3 and anti-CD19 bispecific antibody contained therein.
[0058] The present invention also provides a recombinant DNA expression vector, the recombinant DNA expression vector comprises nucleotide sequence or a combination thereof.
[0059] The present invention also provides a host cell for the transfected recombinant DNA expression vector, which is characterized in that the host cell includes prokaryotic, yeast or mammalian cells.
[0060] The present invention further provides a medicament or a pharmaceutical composition, characterized in that the medicament or the pharmaceutical composition comprises anti-CD3 and anti-CD19 bispecific antibodies.
[0061] The present invention ...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com