Chlorella polysaccharide
A technology of chlorella and chlorella powder, applied in the direction of anti-tumor drugs, food science, drug combination, etc., to achieve the effect of low production cost, simple extraction process, and excellent body immunity
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0019] A kind of chlorella polysaccharide, the extraction step of polysaccharide is:
[0020] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder and water is 1:40, add active peptides, the amount added is 0.04% of the weight of chlorella powder, the amino acid sequence of active peptides is QSGFCTSYYCSKFCGTAGSLYGNLTPGKICCLHCSS , using sodium phosphate buffer as the extractant, the pH of the sodium phosphate buffer is 7.1, at -20°C and 37°C, freeze-thaw 5 times, each 4h, ultrasonic treatment, ultrasonic power 500w, time is 10min, 8000r / min, centrifuge for 8min, take the supernatant to get the crude protein extract;
[0021] 2) Put the supernatant into a vacuum concentration tank and vacuum concentrate to 1 / 5 of the original volume. The vacuum concentration pressure is below -0.9Mpa. Add 85% ethanol solution to the concentrate, stir for 14 minutes, and centrifuge to obtain crude polysaccharides;
[0022] 3) To redissolve, add 20% trichl...
Embodiment 2
[0026] A kind of chlorella polysaccharide, the extraction step of polysaccharide is:
[0027] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder to water is 1:38, add active polypeptide, the added amount is preferably 0.03% of the weight of chlorella powder, the amino acid sequence of the active polypeptide is QSGFCTSYYCSKFCGTAGSLYGNLTPGKICCLHCSS, choose sodium phosphate buffer as the extractant, the pH value of sodium phosphate buffer is preferably 7.0, freeze and thaw 5 times at -20°C and 37°C, each time 4h, ultrasonic treatment, the ultrasonic power is preferably 600w , the time is 10min, 7500r / min, centrifuge for 10min, get the supernatant to get the crude protein extract;
[0028] 2) Put the supernatant into a vacuum concentration tank and vacuum concentrate to 3 / 10 of the original volume. The vacuum concentration pressure is below -0.9Mpa. Add 90% ethanol solution to the concentrate, stir for 15 minutes, and centrifuge to obtain ...
Embodiment 3
[0033] A kind of chlorella polysaccharide, the extraction step of polysaccharide is:
[0034] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder to water is 1:47, add active peptides, the amount added is 0.05% of the weight of chlorella powder, the amino acid sequence of active peptides is QSGFCTSYYCSKFCGTAGSLYGNLTPGKICCLHCSS , using sodium phosphate buffer as the extractant, the pH of sodium phosphate buffer is 6.9, at -20°C and 37°C, freeze-thaw 4 times, each time 3.5h, ultrasonic treatment, ultrasonic power 450w, time 10min, 6000r / min, centrifuge for 12min, take the supernatant to obtain crude protein extract;
[0035] 2) Put the supernatant into a vacuum concentration tank to vacuum concentrate to 1 / 10 of the original volume, the vacuum concentration pressure is below -0.9Mpa, add 85% ethanol solution to the concentrate, stir for 20 minutes, and centrifuge to obtain crude polysaccharide;
[0036] 3) To redissolve, add 18% trichlor...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com