Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A tumor precision T cell containing an efficient killing mechanism and its use

A cell and tumor technology that can be used in the fields of immunology and cell biology to solve problems such as decreased therapeutic efficacy

Active Publication Date: 2020-09-15
SHANGHAI CELL THERAPY RES INST +2
View PDF1 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, CAR + The "cascade" effect caused by off-target T cells is very fast, and these suicide systems may not be able to function in time
Another approach is to reduce CAR + The number of T cells reinfused, this program will reduce the efficacy of treatment

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A tumor precision T cell containing an efficient killing mechanism and its use
  • A tumor precision T cell containing an efficient killing mechanism and its use
  • A tumor precision T cell containing an efficient killing mechanism and its use

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0086] Example 1: Synthesis of CAR expression cassette and construction of expression vector

[0087] According to the composition structure of herinCAR (for the model diagram, see figure 1 ), spliced ​​into the whole fusion amino acid sequence and coding DNA expression frame:

[0088] The amino acid residue sequence of herinCAR is:

[0089] GGGGGGGGG GGGGGGGGG FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR(SEQ ID NO:1)。

[0090] Among them, the signal peptide (MALPVTALLLPLALLLHAARPS, SEQ ID NO:3) is underlined with a dotted line, and the CD20 epitope (NIYNCEPANPSEKNSPSTQYCYSI, SEQ ID NO:4) recognized by the CD20 commercial antibody MatThera is underlined with a wavy line, and the linker sequence with a single underline. Bold is HERIN (GTHSLPPRAAVVPLRMQPGPAHPVLSFLRPS...

Embodiment 2

[0101] Example 2: Isolation and culture of cholangiocarcinoma tissue-derived TIL

[0102] Collect freshly resected cholangiocarcinoma specimens and process them immediately under sterile conditions. The specific method is as follows: remove the normal tissue and necrotic area around the cholangiocarcinoma specimen, and remove the 1-2mm in size from different areas of the specimen 3 Place a small tissue block in each well of a 24-well plate. Add 2 mL of complete medium (GT-T551 medium containing 10% FBS) and 3000 IU / mL IL-2 to each well. Place the 24-well plate at 37 °C, 5% CO 2 cultured in an incubator. On the 5th to 6th day after the initiation of culture, a half-volume medium change was performed for all wells. Afterwards, according to the growth of tumor infiltrating lymphocytes (tumor infiltrating lymphocytes, TIL), a half-volume liquid change was performed every 1-2 days. Once the wells were overgrown with TILs and all adherent cells had been removed, the TILs in e...

Embodiment 3

[0104] Example 3: Genetic Modification of TIL Cells

[0105] Collect 1×10 7 For TIL cells (prepared in Example 2), transfect 6 μg of the pNB328-herinCAR plasmid (prepared in Example 1) into the nucleus through a Lonza 2b-Nucleofector instrument, place at 37°C, 5% CO 2 Culture in an incubator; transfer to a 6-well plate containing 30ng / mL anti-CD3 antibody and 3000IU / mL IL-2 (purchased from Novoprotein Company) after 6 hours, and place at 37°C, 5% CO 2 Incubator culture. After the cells were confluent, they were subcultured at a ratio of 1:5. The TIL cells containing herinCAR, referred to as Bz-T cells, were obtained and used in the following Examples 4-7.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

Provided are a chimeric antigen receptor having medium affinity binding characteristics to tumour cell surface broad spectrum expressed membrane antigens and a T-cell containing the chimeric antigen receptor gene, also known as BaiZe T. The chimeric antigen receptor rapidly starts T-cell activation, and the activation signal will overlay with the TCR signal which naturally recognizes tumour antigen in the tumour-specific T-cell, thereby activating the tumour-specific T-cell, so that same can proliferate and grow in the tumour micro-environment, and precisely killing the tumour cells through tumour antigen-specific TCR.

Description

technical field [0001] The invention belongs to the field of immunology and cell biology, and relates to tumor precision T cells containing an efficient killing initiation mechanism and uses thereof. Specifically, it relates to a T cell therapy technology, in particular, this technology targets tumor-specific T cells, and transfers elements that can quickly initiate and enhance the killing function of T cells through transgenic modification methods, such as recognizing the broad-spectrum expression of tumor cells, Moderate affinity chimeric antigen receptor gene. The present invention also relates to the use of the obtained T cells for treating malignant tumors. Background technique [0002] In recent years, tumor immunotherapy has made major breakthroughs. Using chimeric antigen receptors (chimeric antigen receptors, CAR) modified T cells (CAR-T for short) to treat relapsed and refractory B-cell leukemia, the effective rate reached 90%; using PD-1 antibody monotherapy to ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C12N5/10A61K35/17A61K39/395A61P35/00
CPCA61K35/17A61K39/395C07K16/28C12N5/10
Inventor 钱其军金华君李林芳叶真龙章浩王颖吴红平吴孟超
Owner SHANGHAI CELL THERAPY RES INST
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com