Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Use of vMIP and congeneric E protein ligand in pharmacy

A protein and drug technology, which is applied to the application field of vMIP and its similar E protein ligands in pharmaceuticals, can solve problems such as impossible to talk about, leukocyte decline, etc., and achieves good prospects and improves the effect of medicinal effects.

Inactive Publication Date: 2004-01-28
JINAN UNIVERSITY
View PDF0 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Why did the white blood cells of SARS patients drop sharply? What pathological mechanism forms the patient's lung lesions? Due to the lack of understanding of the virus invasion mechanism, it is impossible to talk about specific and effective prevention and treatment methods

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0018] The present invention is further described through the following examples.

[0019] Experiments show that the gene expression product of E protein has the effect of binding to the ligand vMIP of the seven transmembrane receptor.

[0020] The results are obtained from the data of the following test process:

[0021] 1. Application of computer software analysis shows that the homology between E protein and human seven transmembrane receptors is: E protein: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV

[0022] E protein: 19 LFLAFVV-FLL-VT---LAILTAL---RL 39

[0023] LFLAF+V +LL V+ L ILT L RL7 Transmembrane receptor 1: 48 LFLAFLVIYLLTVSGNGLIILTVLVDIRL 76 (gi 21928315, human chromosome 11) 7 Transmembrane receptor 2: 52 LFLAFLVIYLLTVSGNGLIILTVLVDIRL 80 (gi 20558770) 7 Transmembrane receptor 3: 48 LFLAFLVIYLLTVSGNGLIILTVLVDIRL 76 (gi 20884785) E protein: 19 LFLAFVV-FLL-VT--LAILTALRLCAYCCNIVNVSLVKP 54

[0024] LFLAF+V +LL V+ L ILT...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention refers to the new use of HHV8 chemotactic factor vMIP and the ramification and other albumen factor in the pharmacy field, especially refers to the use in preventing and curing the SARScorresponding Coronaviridae infection. The invention uses vMIP-I, vMIP-II, vMIP-III of recombined HHV8, combines the process that the E albumen of SARS coronaviridae can resist the virus infecting the cell, the invention has prominent effect on decreasing the infection rate of SARS coronaviridae to kidney cell Vero E6, the mechanism is that the combination with homologous E albumen receiver prevents the infection, so it is possible that human control SARS disease effectively.

Description

Technical field [0001] The present invention relates to the new use of the viral chemokine vMIP and its derivatives and other ligand protein-like factors that can be combined with the SARS coronavirus E protein pseudo-receptor in the pharmaceutical field, in particular to the preparation and prevention of human SARS (severe acute Respiratory Syndrome) in the application of drugs related to coronavirus infections. Background technique [0002] Since November 2002, the SARS coronavirus has spread rapidly around the world in just six months, with more than 8,000 cases and more than 500 deaths. [0003] At the beginning of the SARS epidemic, people thought it was a myxovirus-rich virus, but soon from a transmission electron microscope photo, people began to believe that the culprit of SARS was the coronavirus, and soon it was confirmed and completed by laboratories in Canada, China, and the United States almost at the same time. Genome sequencing of the virus, currently known SARS vi...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A61K38/16A61P11/00A61P31/14
Inventor 孙晗笑利奕成刘俊云乔英飒
Owner JINAN UNIVERSITY
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com