Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Tumor precision T cell containing efficient killing starting mechanism and application of tumor precision T cell

A cell and tumor technology, applied in the field of immunology and cell biology, can solve the problem of declining therapeutic efficacy

Active Publication Date: 2016-02-17
SHANGHAI CELL THERAPY RES INST +2
View PDF1 Cites 52 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, CAR + The "cascade" effect caused by off-target T cells is very fast, and these suicide systems may not be able to function in time
Another approach is to reduce CAR + The number of T cells reinfused, this program will reduce the efficacy of treatment

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Tumor precision T cell containing efficient killing starting mechanism and application of tumor precision T cell
  • Tumor precision T cell containing efficient killing starting mechanism and application of tumor precision T cell
  • Tumor precision T cell containing efficient killing starting mechanism and application of tumor precision T cell

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0086] Example 1: Synthesis of CAR expression cassette and construction of expression vector

[0087] According to the composition structure of herinCAR (for the model diagram, see figure 1 ), spliced ​​into the whole fusion amino acid sequence and coding DNA expression frame:

[0088] The amino acid residue sequence of herinCAR is:

[0089] GGGGGGGGG GGG GGGGGG FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR(SEQIDNO:1)。

[0090] Among them, the signal peptide (MALPVTALLLPLALLLHAARPS, SEQIDNO:3) is underlined with a dotted line, and the CD20 epitope (NIYNCEPANPSEKNSPSTQYCYSI, SEQIDNO:4) recognized by the CD20 commercial antibody MabThera is underlined with a wavy line, and the linker sequence is underlined. Bold is HERIN (GTHSLPPRAAVVPLRMQPGPAHPVLSFLRPSWDLVSAFYSLPLA...

Embodiment 2

[0101] Example 2: Isolation and culture of cholangiocarcinoma tissue-derived TIL

[0102] Collect freshly resected cholangiocarcinoma specimens and process them immediately under sterile conditions. The specific method is as follows: remove the normal tissue and necrotic area around the cholangiocarcinoma specimen, and remove the 1-2mm in size from different areas of the specimen 3 Place a small tissue block in each well of a 24-well plate. Add 2 mL of complete medium (GT-T551 medium containing 10% FBS) and 3000 IU / mL IL-2 to each well. Place the 24-well plate at 37 °C, 5% CO 2 cultured in an incubator. On the 5th to 6th day after the initiation of culture, a half-volume medium change was performed for all wells. Afterwards, according to the growth of tumor infiltrating lymphocytes (tumorinfiltratinglymphocyte, TIL), a half volume of medium was changed every 1-2 days. Once the wells were overgrown with TILs and all adherent cells had been removed, the TILs in each overg...

Embodiment 3

[0104] Example 3: Genetic Modification of TIL Cells

[0105] Collect 1×10 7 TIL cells (prepared in Example 2), transfected 6 μg of pNB328-herinCAR plasmid (prepared in Example 1) into the nucleus by Lonza2b-Nucleofector instrument, placed at 37 ° C, 5% CO 2 Culture in an incubator; transfer to a 6-well plate containing 30ng / mL anti-CD3 antibody and 3000IU / mL IL-2 (purchased from Novoprotein) after 6 hours, and place at 37°C, 5% CO 2 Incubator culture. After the cells were confluent, they were subcultured at a ratio of 1:5. The TIL cells containing herinCAR, referred to as Bz-T cells, were obtained and used in the following Examples 4-7.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the fields of immunology and cell biology, and relates to a tumor precision T cell containing an efficient killing starting mechanism and an application of the tumor precision T cell, in particular to a CAR (chimeric antigen receptor) having moderate-affinity binding characteristic with a broad-spectrum expression membrane antigen on the tumor cell surface as well as a new-generation tumor precision T cell, namely, Baize T. T cell activation is started rapidly under the action of the CAR having the moderate-affinity binding characteristic, an activation signal of the CAR is superposed with a TCR (T cell receptor) signal with tumor antigen natural recognition capacity in a CTL (tumor-specific cytotoxic T lymphocyte), the CTL is activated to proliferate and grow in a tumor microenvironment, and a tumor cell is killed preciously by the tumor-antigen-specific TCR. The tumor precision T cell has broad anti-tumor application prospect.

Description

technical field [0001] The invention belongs to the field of immunology and cell biology, and relates to tumor precision T cells containing an efficient killing initiation mechanism and uses thereof. Specifically, it relates to a T cell therapy technology, in particular, this technology targets tumor-specific T cells, and transfers elements that can quickly initiate and enhance the killing function of T cells through transgenic modification methods, such as recognizing the broad-spectrum expression of tumor cells, Moderate affinity chimeric antigen receptor gene. The present invention also relates to the use of the obtained T cells for treating malignant tumors. Background technique [0002] In recent years, tumor immunotherapy has made major breakthroughs. Using chimeric antigen receptors (chimeric antigen receptors, CAR) modified T cells (CAR-T for short) to treat relapsed and refractory B-cell leukemia, the effective rate reached 90%; using PD-1 antibody monotherapy to ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C12N5/10A61K35/17A61K39/395A61P35/00
CPCA61K39/395C07K16/28C12N5/10A61K39/4631A61K2239/38A61K2239/31A61K39/4644A61K2239/53A61K39/4611
Inventor 钱其军金华君李林芳叶真龙章浩王颖吴红平吴孟超
Owner SHANGHAI CELL THERAPY RES INST
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More