Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Application of hybrid antibacterial peptide as the feed supplement

A technology of hybrid antibacterial peptides and feed additives, applied in the biological field, can solve problems such as restricted use, and achieve the effects of increasing resistance, wide application range and strong hemolysis

Inactive Publication Date: 2014-03-12
钱坤
View PDF4 Cites 9 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004]Melittin is the main active ingredient of Italian bee (Apismellifera) venom, an antibacterial peptide isolated from bee venom by Habermanm et al. , anti-inflammatory, anti-radiation, anti-arthritis, anti-tumor, anti-AIDS, and cardiovascular effects, especially against Staphylococcus aureus, but melittin has strong hemolytic properties, which limits further clinical use

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of hybrid antibacterial peptide as the feed supplement
  • Application of hybrid antibacterial peptide as the feed supplement
  • Application of hybrid antibacterial peptide as the feed supplement

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0016] (1) Design of antimicrobial peptides

[0017] According to the primary structure of melittin: GIGAVLKVLTTGLPALISWIKRKRQQ and the primary structure of melittin: GSKKPVPIIYCNRRTGKCQRM, a new antimicrobial peptide was designed: the N-terminus is amino acids 12-26 of melittin, and mutated into GLPLLISWIKRKRQQ9 (amino acids in italics are mutated amino acids) ; The C-terminus is a complete death protein, after connecting with AGP in the middle, the primary structure of the designed antimicrobial peptide is GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM (amino acid abbreviation rules: glycine G, serine S, alanine A, threonine T , valine V, isoleucine I, leucine L, tyrosine Y, phenylalanine F, histidine H, proline P, aspartic acid D, methionine M, Glutamate E, Tryptophan W, Lysine K, Cysteine ​​C, Arginine R).

[0018] (2) Construction of recombinant expression vector

[0019] See the build process figure 1 .

[0020] 1) Design the three-segment primer of the primer:

[0021]...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the biotechnological field, and particularly relates to a technique for preparing a feed supplement through gene recombination of designed antibacterial peptide in yeast. The application of hybrid antibacterial peptide as the feed supplement is characterized by comprising the following steps: performing gene recombination of the hybrid antibacterial peptide onto a pRHZ-41L carrier, wherein the hybrid antibacterial peptide adopts a primary structure of GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM; transforming the recombinant carrier into S. pombe; cultivating on an MAA solid medium for 5 days; picking single colony from the solid medium to be inoculated onto a liquid EMM culture medium for cultivation for 3 days; cultivating engineering bacteria in an enlarged scope; filtering out the culture medium after large scale fermentation of the engineering bacteria, and adding into feed or drinking water after drying. According to the invention, the S.pombe can be directly used for expressing the antibacterial peptide, and then directly for preparing the feed supplement, so that the protein separation and purification process can be omitted, and accordingly, the production cost is reduced, the livestock resistibility is increased, and the use of antibiotics is reduced.

Description

technical field [0001] The invention belongs to the field of biotechnology, in particular to the technology of recombining designed antibacterial peptide genes in yeast to prepare feed additives. Background technique [0002] Antibacterial peptides (antibacterial peptides) are a class of peptides with a small molecular weight, most of them are composed of 13-45 amino acids, some antibacterial peptides are all composed of L-amino acids, and some antibacterial peptide molecules contain both L-amino acids and D -Amino acid, the molecular weight is generally several thousand Daltons, often positively charged, in 1980, Hultmark et al. first isolated a cecropin from the pupa of Hyatophoracecropia, and named it cecropin. Antibacterial peptides have antibacterial, antiviral, antitumor and other activities, good water solubility, and high temperature resistance. Moreover, antimicrobial peptides are generally small peptides, which can be completely digested by animals, and there is n...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A23K1/17A23K20/195
Inventor 钱坤周国庆文良柱沈子龙葛海霞孙来玉肖莉张海洋徐秀芳
Owner 钱坤
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More