Monoclonal antibody against human neurofilament medium molecular weight subunit and preparation method and application thereof
A monoclonal antibody, molecular weight technology, used in biochemical equipment and methods, anti-animal/human immunoglobulin, analytical materials, etc., can solve the problems of high sensitivity, lack of sensitivity, inconvenient inspection and diagnosis, etc., to achieve high sensitivity , a strong specific effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0018] Example 1 Preparation of anti-NF-M monoclonal antibody
[0019] 1. Selection, synthesis and coupling of human NF-M peptide sequence
[0020] The amino acid sequence of NF-M is highly homologous in humans, rats, and mice. How to choose the antigen is crucial to whether BALB / c mice can stimulate an immune response. The antigenic determinants of proteins mostly exist at the C-terminus or N-terminus. After comparing the differences in the amino acid sequence of human, rat, and mouse NF-M, we selected an amino acid sequence at the N-terminus of the NF-M amino acid sequence. GNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSP-C, synthetic peptide, Sulfo-SMCC method coupled with KLH to prepare complete antigen NF-M-KLH, the coupling rate was 92.37%.
[0021] 2. Animal immunity
[0022] The NF-M-KLH conjugate has high coupling efficiency, stable coupling antigen, good solubility, and strong immunogenicity.
[0023] The NF-M-KLH conjugate was formulated into a 1mg / ml solution, and a small-dose long-p...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap