Method for selecting biological binding molecules
A technology that combines molecules and biology, applied in the fields of biomaterial analysis, biological testing, chemical instruments and methods, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0043] The amino acid sequence of the mutant receptor is known from genetic studies on CLL. The receptor consists of two amino acid chains, a light chain (LC) and a heavy chain (HC).
[0044] R110 HC: SEQ ID NO 1
[0045] EVQLVESGGGLVKPGGSLRLSCAASGFTFRSYSMNWVRQAPGKGLEWVSSIISSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCARDQNAMDVWGQGTTVTVSSDSASAPTLFPLVSCENSPSDTSVAVGCLAQDFLPDSITFSWKYKNNSDISSTRQHPSVLRGGKYNNPLHAATSQVLLPSKDPNGNKVKVGT
[0046] R110 LC: SEQ ID NO 02
[0047] IRSLEATMAWTVLLLGLLSHCTGSVTSYELTQPPSVSVAPGKTARITCAGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSGSDHPWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS*EFRPS
[0048] The corresponding phylotype BCR has the following sequence
[0049] WT HC: SEQ ID NO 03
[0050] EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDQNAMDVWGQGTTVTVSSDSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSD...
Embodiment 2
[0089] The same hybridoma as in Example I was used. Only the selection method is different. Selection in this case was performed using TKO cells that had previously been incubated to expose to BCR antigen (5 pg / ml, 5 minutes). This forms the binding of the antigen to the BCR. Activation of the BCR (and actual internalization of the BCR) does not occur because SLP65 is not induced. Cells are then separated. A portion was measured in a BD Fortessa II FACS device for functional testing. This device allows the measurement to be interrupted and the recording to be repeated with new parameters. Most other FACS equipment cannot do this. For this, cells were incubated with indole-1 according to the manufacturer's instructions for 45 min prior to measurement. Indole-1 produces a fluorescent signal upon calcium influx into the cell, which can then be measured by the FACS device. Measure these cells for one minute to generate a baseline. 4-OH-Tamoxifen (2mM) was then added, there...
Embodiment III
[0091] Cells were then incubated with potential inhibitors (5 μg / ml, 5 min) prior to stimulation. These cells are then stimulated with an agonist (antigen, see Example 2) (or in the case of autonomously active cells without stimulation, since the stimulator is on the cell itself) and the subsequent Ca signaling will be inhibited with an inhibitor Compared to the Ca signal of cells without inhibitor. Suppression means that the CA signal is significantly smaller (at least 50% of the net contrast signal) in cells with the inhibitor.
[0092] To screen in this case the following were used: (induced means, the cells had been previously treated with hydroxytamoxifen)
[0093] Induced control group (transformation vector without BCR)
[0094] Induced cells: transformed with a vector carrying DNA encoding the CLL-R110G BCR
[0095] Induced cells: transformed with a vector carrying DNA encoding for the germline-type BCR to form R110G
[0096] In the case of BCRs that are not autono...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap