Botulinum neurotoxin protein crystal structure and crystal preparation method and determination method
A technology of botulinum toxin, crystal structure, applied in biological field
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0035] The preparation of embodiment 1 botulinum toxin protein crystal
[0036] Due to the complex structure of the wild-type BONT protein and its great toxicity, the amino acid sequence provided by the present invention is a functional fragment of the functional domain of the BONT protein specifically selected by the inventor (with a biologically active fragment of the BONT protein), which can not only A large amount of recombinant expression in bacilli can also obtain recombinant proteins with biological activity.
[0037] The functional fragment of the BONT protein functional domain selected in the present invention and the amino acid sequence of the BONT protein functional domain are as shown in SEQ ID NO: 1, specifically:
[0038] MKNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIE VILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLN YGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGR LIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLY DNQSNSGILKDFWGDYLQYDKP...
Embodiment 2
[0055] Example 2 Screening and structural analysis of botulinum toxin protein functional domain crystals
[0056] Concentrate the purified BONT protein to 12mg / ml, mix with buffer pH 7.6, 20mM Tris-HCl and 0.5M NaCl, incubate on ice for 1h, centrifuge at 12000r / min for 30min at 4°C, and use the sitting drop method initial screening. The growth conditions are as follows: add 500ul of pool solution to each well of the seat drop plate, add growth droplets containing 1 μL of protein complex and 1 μL of pool solution to the crystal wells, culture at 20°C for 1 week, and observe with a polarizing microscope . Optimizing the conditions for better crystal growth, the pendant drop method was used to optimize the crystal conditions until a single crystal with better crystal shape and strong diffraction ability was obtained (attached Figure 4 ). The conditions of the final crystallization pool solution were 0.1M Hepes (pH7.5), 12%polyethylene glycol 8000, 8% glycerol and 100mM NaCl. ...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap