A kind of method and application of improving microbial organic selenium synthesis ability based on sulfur-containing protein overexpression
A microorganism and organic selenium technology, applied in the field of organic selenium production and selenium enrichment, can solve the problems of exceeding the consumption capacity of the general population, harsh nutritional conditions of brewer's yeast, and high price of selenium-enriched yeast products, achieving obvious transformation effect of organic selenium and improving biological The effect of material yield, high-efficiency selenium enrichment and safety
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0041] Example 1 Construction of artificially designed AC sulfur-containing protein recombinant yeast and determination of selenium-enriching ability
[0042] 1. Design of artificial sulfur-containing protein AC and its gene sequence
[0043] 1) Artificially design an alanine-cysteine polymer as a sulfur-containing protein, with a total of 40 amino acids (AC40 for short), and its amino acid sequence is (AC)20. Among them, A represents alanine, C represents cysteine, and there are 20 sulfur-containing amino acids, accounting for 50%.
[0044] The total length of the AC gene sequence plus the start and stop codons is 126bp, and the sequence is as follows:
[0045] ATG (GCCTGC) 20 TGA (shown in SEQ.ID.NO.1).
[0046] 2) According to the yeast codon preference, optimize the codon sequence of AC40, determine its gene sequence, and add enzyme cutting sites upstream and downstream as follows:
[0047]
[0048] 2. Construction of recombinant expression vector
[0049] The ge...
Embodiment 2
[0064] Example 2 Construction of artificially designed MC sulfur-containing protein recombinant yeast and determination of selenium-enriching ability
[0065] 1. Design of artificial sulfur-containing protein MC and its gene sequence
[0066] 1) Artificially design a sulfur-containing protein composed of methionine and cysteine, with a total of 74 amino acids (referred to as MC74), which contains several gaps of glycine to meet the requirements of the protein structure, and the sequence is GG(MMMMMMGGCCGG)6. Among them, G represents glycine, M represents methionine, C represents cysteine, and the number of sulfur-containing amino acids is 48, accounting for about 65%. The total length of the MC gene sequence plus the start and stop codons is 228bp, and the sequence is as follows:
[0067] ATGGGTGGT (ATGATGATGATGATGATGGGTGGTTGTTGTGGTGGT) 6 T GA (as shown in SEQ.ID.NO.2).
[0068] 2) According to the yeast codon preference, optimize the codon sequence of MC74, determine its g...
Embodiment 3
[0085] Example 3 Construction of natural MT sulfur-containing protein recombinant bacteria and determination of selenium-enriching ability
[0086] 1. Natural rabbit metallothionein MT and its gene sequence
[0087] The most representative of natural sulfur-containing proteins is metallothionein MT, which is a metal-binding protein naturally formed in the process of biological evolution, and contains more sulfur-containing amino acids—cysteine. Studies have shown that the MT sequence is highly conserved, and the content of cysteine is about 1 / 3 of the total amino acids. In this embodiment, the rabbit source MT protein is selected from the NCBI protein sequence database as a representative of natural sulfur-containing protein, and its amino acid sequence is:
[0088] MDPNCSCPTGGSCSCAGSCTCKACRCPSCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCCA.
[0089] A total of 61 amino acids (MT61), of which C represents cysteine, a total of 20, sulfur-containing amino acids accounted for 32.8%. Addin...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com