Method for extracting low-molecular-weight kelp fucoidin
A kelp fucoidum, low molecular weight technology, applied in the field of polysaccharide extraction, to achieve the effects of high polysaccharide yield, high antitumor activity and good solubility
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0015] A method for extracting low-molecular-weight kelp fucoidan includes cell wall breaking; crude polysaccharide extraction; polysaccharide extraction, separation and purification. The specific operation steps are as follows:
[0016] Cell wall breakage: Take 12 parts of fucoid powder and soak in absolute ethanol for defatting. The solid residue is extracted with water and the ratio of material to liquid is 1:11m / V. Stir for 27min, and let it stand for 4.5h in a sealed state. Add active peptide. The amount of active peptide is fucoid powder 0.05% of the weight, the amino acid sequence of the active peptide is: HSHACASYYCSKFCGSCTHYLCRVLHPGKNCSR, stirring for 6min, steam explosion treatment, pressure 2.4MPa, maintaining 35s, to obtain cell crushing liquid; during the steam explosion process, the vapor infiltration in the cell wall is limited, which will cause The degree of wall breakage is not high. By adding active peptides, the active peptides act on the surface of the kelp fuc...
Embodiment 2
[0021] A method for extracting low-molecular-weight kelp fucoidan includes cell wall breaking; crude polysaccharide extraction; polysaccharide extraction and separation and purification. The specific preferred operation steps are as follows:
[0022] Cell wall breakage: Take 15 parts of fucoid powder and soak in absolute ethanol for defatting. The solid residue is extracted with water and the material-liquid ratio is 1:14m / V. Stir for 28min, and let it stand in a sealed state for 5h. Add active polypeptide. The amount of active polypeptide is the weight of fucoid powder. The amino acid sequence of the active peptide is: HSHACASYYCSKFCGSCTHYLCRVLHPGKNCSR, stirring for 6min, steam explosion treatment, pressure 2.5MPa, maintaining 35s, to obtain cell crushing liquid; during the steam explosion process, the vapor infiltration in the voids of the cell wall is limited, which will cause destruction The wall degree is not high. By adding active peptides, the active peptides act on the sur...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com