Eureka AIR delivers breakthrough ideas for toughest innovation challenges, trusted by R&D personnel around the world.

Application of pilose antler peptide in promoting proliferation of mesenchymal stem cells

A technology of stem cells and velvet antler polypeptide, applied in the field of biomedicine, can solve the problems of high price of cytokines, difficult to widely use, etc., and achieve the effect of significant effect, promoting the repair of kidney damage and promoting the proliferation of ADSCs cells.

Inactive Publication Date: 2017-02-01
DALIAN UNIV OF TECH
View PDF1 Cites 7 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The laboratory often uses cytokines to promote cell proliferation, but cytokines are expensive and difficult to be widely used

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of pilose antler peptide in promoting proliferation of mesenchymal stem cells
  • Application of pilose antler peptide in promoting proliferation of mesenchymal stem cells
  • Application of pilose antler peptide in promoting proliferation of mesenchymal stem cells

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0032] The effect of different concentrations of velvet antler polypeptide on the cell proliferation was detected by MTT method after 24 hours of action on the cells.

[0033] The first step: cell culture. Cell culture uses low-sugar DMEM medium with 10% serum content, using 75cm 2 Cell culture flasks, at 37°C, 5% CO 2 cultured in an incubator.

[0034] Step Two: Cell Digestion. Adipose-derived mesenchymal stem cells (ADSCs) in good growth condition in the logarithmic growth phase were taken and digested routinely. When digesting, first add 4ml PBS to wash the adipose-derived mesenchymal stem cells (ADSCs), wash twice, wash away the residual medium, and prevent the neutralization of the residual medium and trypsin. Then add 4ml of trypsin, put in 37 ℃, 5% CO 2 Digest in an incubator for 1 min. When the cells shrank, an equal amount of culture medium was added to terminate the digestion. Blow the wall of the cell flask with a disposable sterile plastic tube to blow the c...

Embodiment 2

[0043] The effect of different concentrations of velvet antler polypeptide on the cell proliferation was detected by MTT method after 48h of action on the cells.

[0044] The first step: cell culture. Cell culture uses low-sugar DMEM medium with 10% serum content, using 75cm 2 Cell culture flasks, at 37°C, 5% CO 2 cultured in an incubator.

[0045] Step Two: Cell Digestion. Adipose-derived mesenchymal stem cells (ADSCs) in good growth condition in the logarithmic growth phase were taken and digested routinely. When digesting, first add 4ml PBS to wash the adipose-derived mesenchymal stem cells (ADSCs), wash twice, wash away the residual medium, and prevent the neutralization of the residual medium and trypsin. Then add 4ml of trypsin, put in 37 ℃, 5% CO 2 Digest in an incubator for 1 min. When the cells shrank, an equal amount of culture medium was added to terminate the digestion. Blow the wall of the cell flask with a disposable sterile plastic tube to blow the cells ...

Embodiment 3

[0054] The effect of different concentrations of velvet antler polypeptide on cell proliferation was detected by MTT method after 72 hours of action on cells.

[0055] The first step: cell culture. Cell culture uses low-sugar DMEM medium with 10% serum content, using 75cm 2 Cell culture flasks, at 37°C, 5% CO 2 cultured in an incubator.

[0056] Step Two: Cell Digestion. Adipose-derived mesenchymal stem cells (ADSCs) in good growth condition in the logarithmic growth phase were taken and digested routinely. When digesting, first add 4ml PBS to wash the adipose-derived mesenchymal stem cells (ADSCs), wash twice, wash away the residual medium, and prevent the neutralization of the residual medium and trypsin. Then add 4ml of trypsin, put in 37 ℃, 5% CO 2 Digest in an incubator for 1 min. When the cells shrank, an equal amount of culture medium was added to terminate the digestion. Blow the wall of the cell flask with a disposable sterile plastic tube to blow the cells off...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the technical field of biological medicines, and discloses application of pilose antler peptide in promoting proliferation of mesenchymal stem cells. The pilose antler peptide which contains 32 amino acids obtained in the invention has an effect on proliferation of the ADSCs (Adipose Tissue-Derived Stromal Cells). The amino acid sequence of the pilose antler peptide is VLSATDKTNVLAAWGKVGGNAPAFGAEALERM. The pilose antler peptide has a most remarkable effect when the concentration of the pilose antler peptide is 20 ug / ml and the acting time is 48 hours, and is beneficial to promoting kidney damage repair and promoting skin wound healing and bone repair.

Description

technical field [0001] The invention belongs to the technical field of biomedicine and relates to the application of velvet antler polypeptides (VAPs) in promoting the proliferation of mesenchymal stem cells (ADSCs). Background technique [0002] Antler - Returns to the liver and kidney meridians, nourishes kidney yang, nourishes essence and blood, and strengthens muscles and bones. Belongs to one of the traditional Chinese medicine. The Pharmacopoeia of the People's Republic of China (1st edition in 2005) describes the functions and indications of velvet antler as: strengthening kidney yang, benefiting essence and blood, strengthening muscles and bones, regulating Chong and Ren, and supporting sores. It is used for impotence and spermatorrhea, infertility due to cold palace, thinness, mental fatigue, chills, dizziness, tinnitus and deafness, cold pain in the waist and knees, cold and limp bones, metrorrhagia, vaginal discharge, and gangrene. [0003] Antler is an animal b...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C12N5/0775C07K14/47
CPCC12N5/0667C07K14/47C12N2501/998
Inventor 张郑瑶王晓龙
Owner DALIAN UNIV OF TECH
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Eureka Blog
Learn More
PatSnap group products