Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

PD-1 blocking agent and its application

A technology of PD-1, 1.PD-1, applied in the fields of medicine and biochemistry, to achieve the effect of improving killing effect and inhibiting activity

Active Publication Date: 2020-08-28
BEIJING DCTY BIOTECH CO LTD
View PDF8 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, there is no disclosed protein in the prior art to block the combination of PD-1 and PDL1

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • PD-1 blocking agent and its application
  • PD-1 blocking agent and its application
  • PD-1 blocking agent and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0080] 1. PD-1 blocking agent

[0081] According to the three-position structure of the interaction between PD-1 and PD-L1, figure 1 , can determine the binding region of PD-1 and PD-L1, SEQ ID No.2~3, SEQ ID No.2: ALIVYWEMEDKNIIQFV, SEQ ID No.3: KLQDAGVYRCMISYGGADYKRITVKVNA, connect these two sequences with a loop sequence, SEQ ID No.4: KFPVEKQLDLA, and change YKR in SEQ ID No.3 to AAA to avoid functional binding and obtain immune checkpoint inhibitory effect of blocking protein, that is, PD-1 blocking agent, SEQ ID No.1 :

[0082] ALIVYWEMEDKNIIQFVKFPVEKQLDLAKLQDAGVYRCMISYGGADAAAITVKVNA; PD-1 blocking agent was synthesized by the peptide synthesis department of GenScript Biotechnology Co., Ltd., with a purity of 98%.

[0083] 2. Fluorescent labeling of PD-1 blocking agent

[0084] 1) Fluorescent labeling kit: Alexa 647 Protein Labeling Kit (A20173)

[0085] 2) Prepare 1M NaHCO 3 : 1 mL of HO 2 O Add Component B, fully dissolve and mix well, store at 4°C and use withi...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides a PD-1 blocking agent and application thereof, and belongs to the technical fields of medical science and biochemistry. The PD-1 blocking agent has an amino acid sequence shownin SEQ ID No.1. The provided PD-1 blocking agent can be effectively bonded with PD-1 on PBMCs to block bonding of the PD-1 and PDL1, block the PBMCs, inhibit the activity of immune checkpoints, release immune brakes in a tumor microenvironment, and improve the killing effect of immune cells on tumors, thereby achieving the anti-tumor effect.

Description

technical field [0001] The invention belongs to the technical field of medicine and biochemistry, and in particular relates to a PD-1 blocking agent and its application. Background technique [0002] PD-1 (programmed cell deathprotein-1, programmed death receptor) is an important inhibitory signaling molecule, through its two ligands PD-L1 (B7-H1 / CD274) and PD-L2 (B7-DC / CD273 ) to inhibit the activation of T cells and the production of cytokines, and play a vital role in maintaining the body's peripheral tolerance. [0003] The immune checkpoint is a protective molecule in the human immune system, which acts like a brake to prevent inflammatory damage caused by excessive activation of T cells. Tumor cells take advantage of the characteristics of the human immune system to overexpress immune checkpoint molecules (such as PD-L1) and bind to PD-1 on lymphocytes to inhibit lymphocytes, including T cells, from exerting anti-tumor capabilities. Thereby inhibiting the response of...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/47
CPCA61K38/16A61P35/00A61P37/04
Inventor 张嵘焦顺昌周子珊
Owner BEIJING DCTY BIOTECH CO LTD
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More