Kit for detecting capripoxvirus serum antibody based on synthetic peptide
A technology of sheep pox virus and serum antibody, which is applied in the direction of biological testing, material inspection products, etc., can solve the problems of low sensitivity and specificity, and achieve the effect of easy operation and reliable technical support
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0023] 1. Use DNAstar software to design two short peptides for the main immune protein P32 of sheep pox virus, and use conventional synthetic peptide methods to synthesize peptides. The sequence of the peptides is:
[0024] A: PELKSDNDIFYKKVDTVKDFKNSDVNFFLKDKKDDI
[0025] B: YKLEKELKLNRQVLNDSSKYILHNTKYLSKKRANEMKN
[0026] 2. Dilute the two synthesized short peptides with 0.5M PBS buffer to 6 μg / ml, then mix A and B in equal volumes, add 50 μL of the mixture of A and B to each well of the ELISA plate, overnight at 4°C, and A is 0.15 μg / well, and B is 0.15 μg / well.
[0027] 3. Discard the liquid in the wells, add 220 μL 1×PBST (phosphate Tween) washing solution to each well, wash 3 times, and spin dry for the last time. Afterwards, 50 μL of blocking solution (1% gelatin) was added to each well, incubated at 37°C for 45 minutes, washed 3 times with PBST, and dried by spinning for the last time.
[0028]
[0029] 4. Dilute the negative and positive serum with PBS to 5 dilutio...
Embodiment 2
[0045] 1-6 steps are the same as in Example 1.
[0046] 7. Preparation of Sample 2 (Goat Pox Positive Serum, Goat Pox Negative Serum)
[0047] For the 5 serum samples from 5 antibody-positive sheep from different sources and 2 serum samples from 2 antibody-negative sheep from different sources, take 5 μL for each, and then add 95 μL PBS respectively, and the total volume of each diluted serum is 100 μL (1 :20 dilution), and stored at -20°C for later use.
[0048] 8. Perform an intra-batch repeatability test on the detection reagents prepared in the same batch, and do 5 wells for each serum sample to repeat the intra-batch repeat test.
[0049] 8.1 Add 50 μL each of the positive and negative serum samples prepared in step 7 to the ELISA plate, repeat for 5 wells, incubate at 37°C for 45 minutes, wash the plate 3 times with PBST, and spin dry the last time (repeat within the batch).
[0050] 8.2 Add 50 μL 1:400 diluted rabbit anti-goat enzyme-labeled secondary antibody to each...
Embodiment 3
[0057] 1-6 steps are the same as in Example 1.
[0058] 7. Preparation of sample 3 (sheep pox vaccine immune serum).
[0059] Purchasing commercially available sheep pox vaccine, immunizing 5 goats according to the vaccine instruction manual, collecting the whole blood of the immunized goat two months after immunization, and separating the serum; at the same time collecting the whole blood of a goat that has not received any vaccine immunization, and separating the serum, all The prepared samples were stored at -20°C for later use.
[0060] 8. The prepared detection reagent is used to detect the immune sheep serum antibody.
[0061] Take 1 part of 5μL sheeppox immune serum and 1 part of 5μL sheeppox non-immune serum from each isolated goat, add 95μL PBS respectively, each with a total volume of 100μL (1:20 dilution), detect and analyze according to the prepared ELISA reagent.
[0062] 8.1 Add 50 μL each of the prepared 5 sheeppox immunized and 1 non-immune serum samples to t...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com