Application of MMP9 inhibitor in preparation of medicine for preventing and/or treating colitis or colon cancer
An MMP9 and inhibitor technology, applied in the application field of MMP9 inhibitor in the preparation of colitis or colon cancer drugs, can solve the problem of no targeted and specific inhibitor and the like
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0035] In some embodiments, the preparation method of MMP9 inhibitor comprises the following steps:
[0036] S01. Design the amino acid mutation sites of CDR1, CDR2 and CDR3 in the CDR region and synthesize the CDRs mutation primers through a large number of sequencing and comparative analysis of multiple natural libraries;
[0037] S02. Provide the synthesized Nanobody template sequence, perform codon optimization on the Nanobody template sequence and introduce a restriction enzyme cleavage site to obtain an optimized Nanobody template sequence;
[0038] S03. Insert the optimized nanobody template sequence into the phagemid carrier to construct a recombinant phagemid, perform phage display on the recombinant phagemid and extract single-stranded DNA, and use the Kunkel mutation method to pair CDRs mutation primers with single-stranded DNA to synthesize heterologous double-stranded DNA, and transformed into Escherichia coli to obtain a phage mutant library;
[0039] S04. Using...
Embodiment 1
[0076] Application of MMP9 inhibitor in the preparation of drugs for preventing and / or preventing and treating colitis or colon cancer
[0077] 其中,MMP9抑制剂选自G3CC,G3CC的氨基酸序列为SEQ.ID No.2为:MKKTAIAIAVALAGFATVAQAAQVQLQESGGGLVQAGGSLRLSCAASGNIFRYRSMGWYRQAPGKERELVAGISRGTTTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVYRNQRVYGRGPVLRPLKYWGQGTQVTVSSGQAGQHHHHHHGAYPYDVPDYAS*。
[0078] The preparation method of MMP9 inhibitor comprises the steps:
[0079] (1) Design the amino acid mutation sites of CDR1, CDR2 and CDR3 in the CDR region and synthesize the CDRs mutation primers through a large number of sequencing and comparative analysis of multiple natural libraries; wherein, the mutation primers for CDR1 are as shown in SEQ.ID No.6 The mutation primer of CDR2 is shown in SEQ.ID No.7, and the mutation primer of CDR3 is shown in SEQ.ID No.8;
[0080] (2) Provide the synthesized Nanobody template sequence, perform codon optimization on the Nanobody template sequence and introduce a restriction endo...
PUM

Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com