Low-molecular-weight kelp fucoidin
A technology of kelp, fucoidan, and low molecular weight, which is applied in the field of polysaccharide extraction to achieve the effects of high polysaccharide yield, increased polysaccharide degradation degree, and increased polysaccharide yield
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0015] A kind of low molecular weight kelp fucoidan, the preparation steps of fucoidan include: cell wall crushing; polysaccharide rough extraction; polysaccharide extraction and separation and purification, the specific operation steps are as follows:
[0016] 1) Cell wall crushing: take 29 parts of fucoidan powder and pass through a 54-mesh mesh sieve, soak in absolute ethanol to degrease, extract the solid residue with water at a ratio of 1:10m / V to solid, stir for 28min, seal and let stand for 3h, add active polypeptide, the active The amount of polypeptide added is 0.04% of the weight of the fucoidan powder. The amino acid sequence of the active polypeptide is: HSHACASYYCSKNFCHGSCTHSYLCRVLHPGKNCSR. Stir for 6 minutes, steam explosion treatment, pressure 2.2MPa, and maintain for 36s to obtain a cell disruption solution;
[0017] 2) Crude polysaccharide extraction: Add 10 parts of deionized water to the cell disruption solution, extract at 64°C for 2 hours, extract twice, co...
Embodiment 2
[0022] A low-molecular-weight kelp fucoidan. The preparation steps of the fucoidan include: cell wall crushing; polysaccharide crude extraction; polysaccharide extraction and separation and purification. The specific preferred operation steps are as follows:
[0023] 1) Cell wall crushing: Take 30 parts of fucoidan powder and pass through a 58-mesh mesh sieve, soak in absolute ethanol to degrease, extract the solid residue with water at a ratio of 1:8m / V to solid, stir for 30min, seal and let stand for 2h, add active polypeptide, and activate The amount of polypeptide added is 0.04% of the weight of the fucoidan powder, and the amino acid sequence of the active polypeptide is: HSHACASYYCSKNFCHGSCTHSYLCRVLHPGKNCSR. Stir for 6 minutes, steam explosion treatment, pressure 2.6MPa, and maintain for 36s to obtain cell disruption solution;
[0024] 2) Crude polysaccharide extraction: Add 10 parts of deionized water to the cell disruption solution, extract at 64°C for 2 hours, extract ...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com