Tumor-associated antigen xage-1b short peptide and its application
A technology of xage-1b and 1.xage-1b is applied to tumor-associated antigen XAGE-1b short peptide and its application field, which can solve the problems of poor specificity of short peptide and unsatisfactory results.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0027] The tumor antigen is XAGE-1b antigen. The XAGE-1b gene is located on the X chromosome (Xp11.21-Xp11.22), with a full length of 622bp, encoding a protein precursor composed of 81 amino acids. The amino acid sequence is as follows (from GenBank: NM_001097594.2):
[0028]MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV (SEQ ID NO: 1)
[0029] The technical solution of the present invention will be further described below in conjunction with experiments.
[0030] Expression of XAGE-1b in non-small cell lung cancer
[0031] XAGE-1 is an important member of the CTA family. In addition to being widely expressed in non-small cell lung cancer, it is also expressed in a variety of malignant tumors. It is extremely important to establish XAGE-1b antigen peptide-specific CTL clones. In the previous study, the inventors randomly selected surgically resected lung cancer specimens (all confirmed by pathological examination and obtained the consent of...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com