Fusion protein of human vascular endothelial growth factor and epidermal growth factor-like domain 7
A technology of epidermal growth factor and fusion protein, applied in the field of fusion protein of human vascular endothelial growth factor and epidermal growth factor-like domain 7, can solve problems such as cardiovascular abnormalities and vascular defects, and achieve the effect of improving the effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0032] Example 1: Construction of VEGF-EGFL7 fusion gene expression system in yeast
[0033] In this example, the gene coding sequences of VEGF and EGFL7 pro-angiogenic active regions were analyzed, and the rigid and elastic linker peptides were used to fuse them together, and the gene coding sequences of serum protein binding domains were added at the ends.
[0034] It mainly includes the following steps:
[0035] 1. Obtain VEGF protein sequence from NCBI
[0036] (http: / / www.ncbi.nlm.nih.gov / protein / 76781480?report=fasta),
[0037] Extract its functional area:
[0038] NHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKD (SEQ ID NO. 1).
[0039] 2. Get the EGFL7 protein sequence from NCBI
[0040] (http: / / www.ncbi.nlm.nih.gov / protein / 7705889?report=fasta),
[0041] Extract its functional area:
[0042] GAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQ (SEQ ID NO. 2).
[0043] 3. Obtain serum protein sequence from NCBI
[0044](http: / / w...
Embodiment 2
[0073] Example 2: Application of VEGF and EGFL7 fusion protein to promote angiogenesis in vitro
[0074] Human umbilical cord vascular endothelial cells (HUVEC) were divided into 1×10 6 The density of each hole was inoculated with Matrigel in 6-well plate, and different concentrations of EGFL7, VEGF and VEGF-EGFL7 fusion protein (0 ng / ml to 100 ng / ml) were added to the serum-free medium, and then the cells were cultured for 3- 6 hours (21% O under normoxia 2 or hypoxic 1% O 2 conditions) cultured. The results are shown in Figure 4. Without the addition of VEGF and EGFL7, the human umbilical cord vascular endothelial cells did not present a vascular network structure ( Figure 4A iv diagram). After adding VEGF or EGFL7 or VEGF-EGFL7 fusion protein in the medium, the cells formed a vascular network structure ( Figure 4A Figures i to iii), the density of vascular network formation was photographed and counted. The results in Fig. 4 show that after adding VEGF or EGFL7 or ...
Embodiment 3
[0075] Example 3: Application of VEGF and EGFL7 fusion protein to promote angiogenesis in vivo
[0076] Establish a rat model of acute myocardial ischemia by ligating the left anterior descending coronary artery, and inject the same concentration (1 to 100 μg / kg) of VEGF or EGFL7 or VEGF-EGFL7 fusion protein around the left anterior descending coronary artery Afterwards, the heart was taken out on the 14th day, and sections were immunohistochemically stained. CD31 was used to mark the vascular endothelial network, and DAP was used to mark the nuclei. As shown in the figure (i-iv of 4C), the immunohistochemical fluorescent staining showed that the density of the vascular network in each group The differences among the groups were obvious; statistics were taken to check the density of vascular network formation, and the degree of difference between the groups was compared. Such as Figure 4D The results showed that, compared with VEGF or EGFL7, VEGF-EGFL7 fusion protein could s...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com