Protein structure prediction method based on tree structure replica exchange and fragment assembly
A protein structure and prediction method technology, applied in the field of three-dimensional structure prediction of protein structure, can solve problems such as inaccurate energy model, difficult protein folding problem, and huge protein conformation space
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0059] The present invention will be further described below in conjunction with the accompanying drawings.
[0060] refer to figure 1 and figure 2 , a method for protein structure prediction based on tree-structured copy exchange and fragment assembly
[0061] , the prediction method includes the following steps:
[0062] A1. For protein conformation processing, the ID number is 1ENH, and its sequence is RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKI. The process is as follows;
[0063] STEP1.1. According to the obtained protein amino acid sequence sequence, use the Rosetta package software pose_from_sequence function to construct a long protein chain;
[0064] STEP1.2, and use the Mover object SwitchResidueTypeSetMover built by Rosetta to obtain the long protein chain, and use its apply method to convert the all-atom conformation of the long protein chain into the bone chain atomic conformation. The protein conformation is represented by pose, which is always red...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com