Method for improving thermal stability of enzyme
A thermostable, recombinant enzyme technology, applied in the direction of enzyme stabilization, microorganism-based methods, biochemical equipment and methods, etc. The effect of easy promotion and simple process
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0023] Example 1: Amino acid sequence of amphipathic short peptide and cloned into plasmid pET-22b(+)
[0024] 1 AEAEAKAKAEAEAKAK
[0025] 2. VNYGNGVSCSKTKCSVNWGQAFQERYTAGTNSFVSGVSGVASGAGSIGIGRR
[0026] 3. DWLKAFYDKVAEKLKEAFKVEPLRADWLKAFYDKVAEKLKEAF
[0027] 4. DWLKAFYDKVAEKLKEAFGLLPVLEDWLKAFYDKVAEKLKEAF
[0028] 5. DWLKAFYDKVAEKLKEAFKVQPYLDDWLKAFYDKVAEKLKEAF
[0029] 6. DWLKAFYDKVAEKLKEAFNGGARLADWLKAFYDKVAEKLKEAF
[0030] According to the above amino acid sequence, the DNA sequence was chemically synthesized, and cloned into the plasmid pET-22b(+) until the plasmid pET-22b(+) / AP
Embodiment 2
[0031] Embodiment 2: Construction of recombinant plasmid pET-22b(+) / AP-enzyme
[0032] The target enzyme gene was cloned into the Nco I and Hind III sites of the expression vector pET-22b(+) / AP. The ligation product was transformed into competent Escherichia coli JM109 for transformation. The conversion method is as follows:
[0033] (1) Under sterile conditions, take 200 μL of competent cells and place them in a sterile microcentrifuge tube;
[0034] (2) Add 1-2 μL of recombinant plasmid to each tube, rotate gently to mix the contents, and place on ice for 30 minutes;
[0035] (3) Heat shock at 42°C for 90s (accurate), do not shake the centrifuge tube;
[0036] (4) Quickly transfer the centrifuge tube to an ice bath to cool the cells for 1-2 minutes;
[0037] (5) Add 800 μL of ordinary LB culture medium without antibiotics to each tube;
[0038] (6) Use a sterile spreader to spread 200 μL of the bacterial solution on an agar plate containing ampicillin, and place it flat...
Embodiment 3
[0040] Example 3: Construction of recombinant enzyme expression strains fused with parental short peptides
[0041] Competent Escherichia coli BL21 (DE3) was transformed. The conversion method is as follows:
[0042] (1) Under sterile conditions, take 200 μL of competent cells and place them in a sterile microcentrifuge tube;
[0043] (2) Add 1-2 μL of recombinant plasmid to each tube, rotate gently to mix the contents, and place on ice for 30 minutes;
[0044] (3) Heat shock at 42°C for 90s (accurate), do not shake the centrifuge tube;
[0045] (4) Quickly transfer the centrifuge tube to an ice bath to cool the cells for 1-2 minutes;
[0046] (5) Add 800 μL of ordinary LB culture medium without antibiotics to each tube;
[0047] (6) Use a sterile spreader to spread 200 μL of the bacterial solution on an agar plate containing ampicillin, and place it flat at 37°C for 20 minutes until the liquid is absorbed, then culture it upside down overnight, and observe.
[0048] Sele...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com