Allogenic animal serum albumin as carrier protein for preparation of semiantigen-antibody
A technology of serum albumin and carrier protein, applied in the field of preparation of hapten antibodies, can solve the problems of influence, unfavorable screening of specific antibody titer monoclonal antibody, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0022] Mouse albumin as a hapten carrier for the preparation of FK506 monoclonal antibody
[0023] We used the fusion method of BALB / C mouse splenocytes and myeloma cells to prepare the monoclonal antibody of FK506 (trade name Prokof), FK506 is a macrolide antibiotic, composed of a semiketone group, Composed of a diketone group and 23 rings, its molecular formula is C 44 h 69 NO 12 ·H 2 O, the molecular weight is 822. Its structural formula is shown in Figure 1. It alone cannot be used as an antigen to immunize animals to obtain specific antibodies, and needs to be coupled with a carrier protein to obtain immunogenicity. We used rivanol method to purify serum albumin of BALB / C homologous mice, obtained derivatives of FK506 by acid anhydride method, and then used EDC method to couple FK506 to homologous animal serum albumin.
[0024] 1. Purification of mouse albumin
[0025] 1) Collect a total of 5ml of mouse serum, centrifuge at 4000rpm / min for 15 minutes at 4°C, and ta...
Embodiment 2
[0063] Mouse albumin as hapten for preparation of BNP monoclonal antibody
[0064] The amino acid sequence of BNP (B-type natriuretic peptide, brain natriuretic peptide) is SSKMYQGSGCPGFKMDRLSSSSGLGCKVLRRR from the amino terminal to the carboxyl group. It is a peptide containing 32 amino acid residues. The relative molecular mass of BNP is 3.46×10 3 , it is not sufficient as a complete antigen to immunize animals, and needs to be conjugated to a carrier protein to obtain immunogenicity. Conjugate with serum albumin using a bifunctional cross-linker method.
[0065] The preparation method of serum albumin is the same as embodiment 1.
[0066] 1. The specific steps of coupling are as follows:
[0067] 1) Take 1mg of recombinant brain nasin (BNP), dissolve it in 1ml of double distilled water, and dissolve 10mg of self-made mouse serum albumin in 1ml of PBS (pH7.5) with a concentration of 0.1mol / L;
[0068] 2) shake and mix the hapten solution and the albumin solution;
[0069...
PUM
Property | Measurement | Unit |
---|---|---|
purity | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com