Peptides with Neuroprotective Effects and Applications
A technology for Alzheimer's disease and drugs, applied in the field of neurotoxic peptides, to achieve good neuroprotective effects, improve neurotoxicity, and maintain expression
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0029] Example 1 Confirming the binding between endogenous ADDLs and EphB2 in the AD mouse model
[0030] Experiments have shown that synthetic ADDLs were found to co-immunoprecipitate with EphB2 in mature hippocampal neurons (Cisse, M., Nature 469, 47-52.2011), but endogenous ADDLs and EphB2 were not detected in the hippocampal tissue of AD model mice Whether in situ binding occurs remains to be studied. The present invention proves the combination of endogenous ADDLs and EphB2 in the hippocampal tissue of AD model mice through a large number of experiments.
[0031] The specific experimental method is:
[0032] 1. Sample preparation: The APP / PSN transgenic AD model mice were decapitated, and the bilateral hippocampus was quickly isolated, and frozen in liquid nitrogen for later use. The following operations were all carried out in an ice-water bath: take out the hippocampus from liquid nitrogen and add homogenization buffer, homogenize at a high speed with a homogenizer (1...
Embodiment 2
[0036] Example 2 Detection of the interaction site between ADDLs and EphB2
[0037] The work of Cisse et al. revealed that the FN domain of EphB2 is the key region for its binding to ADDLs (Cisse, M., Nature 469, 47-52.2011), but the specific amino acid sequence of EphB2 binding to ADDLs is still unclear. The present invention identifies the specific amino acid sequence that ADDLs binds to the FN structural domain of EphB2 through a large number of experiments and according to the detection test of the polypeptide array.
[0038] 1. Peptide array synthesis
[0039] Synthetic array protein information is as follows:
[0040] PSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVQGLKAGAIYVFQFVRARTVAGYGRYSGKM.
[0041] A total of 203 AAs are designed in Overlapping format. Each polypeptide in the array has a length of 10 amino acids and is truncated at intervals of...
Embodiment 3
[0060] Example 3 pep-32 and pep-63 block the interaction between ADDLs and EphB2
[0061] 1. Hippocampal neuron culture: According to the method established by Gao Can et al. (Gao C, et al., JNeurochem.2006; 98:1664-1677), the hippocampus of 17-19-day-old fetal mice or E1 neonatal mice was cut. After crushing, the cells were digested with trypsin, and the resulting cells were cultured in serum-free medium containing B27 supplement for 18-21 days for the experiment.
[0062] 2. Preparation of ADDLs: According to the method of Ronicke et al. (Ronicke R, et al., NeurobioAging. 2011; 32:2219-2228), Aβ 1-42 Dissolve in HFIP first, store in -80°C refrigerator after aliquot evaporation, dissolve in DMSO 24h before use and dilute to serum-free medium, place in 4°C refrigerator for 24h, centrifuge at 14000g for 10min, the supernatant is soluble Aβ oligomerization Body ADDLs.
[0063] Freshly prepared 25ul ADDLs (final concentration 500nM) and 2.5g / ml four interfering peptides (final ...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap