Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Small peptide having tumor targeting and cell penetrating properties and application of small peptide

A tumor targeting and transmembrane technology, applied in the field of molecular biology, to achieve the effect of low hemolytic toxicity

Inactive Publication Date: 2015-04-22
SOUTHEAST UNIV
View PDF3 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] However, whether small peptides with other secondary structures (such as β-sheet structure) can play the same role remains to be studied

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Small peptide having tumor targeting and cell penetrating properties and application of small peptide
  • Small peptide having tumor targeting and cell penetrating properties and application of small peptide
  • Small peptide having tumor targeting and cell penetrating properties and application of small peptide

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0022] Example 1. Synthesis and identification of PTS

[0023] PTS was prepared by Shanghai Keyept Biotechnology Co., Ltd. by solid-phase synthesis, with a purity of >95% ( figure 1 ), the mass spectrometric identification results were consistent with the expected molecular weight ( figure 2 ).

Embodiment 2

[0024] Example 2. Hemolysis test

[0025] Human erythrocytes were washed three times with pH 7.4 PBS solution and resuspended. Add PTS, P1c, and Ts at a final concentration of 0-1.0 mmol / L, incubate at 37°C for 15 min, centrifuge at 5,600×g for 1 min, and detect the absorbance of the supernatant at 350 nm. Calculate the percentage of hemolysis according to the following formula: percentage of hemolysis (%)=(A-A B ) / (A P -A B )×100. A B : Blank control, that is, no peptide was added; A P : Positive control, ie adding 0.2% Triton X-100 leads to complete hemolysis. The experimental results showed that: the three peptides all showed low hemolytic activity, and there was no significant difference in the percentage of hemolysis ( P image 3 ).

Embodiment 3

[0026] Example 3. Flow Cytometry

[0027] Human breast cancer MDA-MB-231 cells were incubated in DMEM containing 10% FBS at 37°C, 5% CO 2 cultivated in a moist environment. Wash twice with cold PBS containing 1% FBS and collect. Then, add or not add 5 μmol / L free P1c or 2 mg / L anti-human αvβ3 monoclonal antibody to the cells, and pre-incubate at 37°C for 1 hour. After washing three times, add FITC-PTS, FITC-P1c or FITC-TS at a final concentration of 2.5 μmol / L, protect from light, and incubate at 37°C for 30min. Cells were washed twice and analyzed by flow cytometry.

[0028] MDA-MB-231 cells were analyzed for integrin αvβ3 expression after incubation of cells with 2.5 mg / L anti-human αvβ3 monoclonal antibody in PBS containing 1% FBS for 1 h at 4 °C. Mouse immunoglobulin (Ig) served as a negative control. After the cells were washed twice, they were incubated with 1 mg / L goat anti-mouse antibody-FITC at 4°C in the dark for 30 min. Cells were washed three times, fixed wit...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a small peptide having tumor targeting and cell penetrating properties and an application of the small peptide. The amino acid sequence of the small peptide is shown in GSKKPVPIIYCNRRSGKCQRMGSIRTPKISKPIKFELSG. The small peptide (PTS) disclosed by the invention shows relatively low hemolytic toxicity in vitro; flow cytometry shows that the FITC-PTS can be specifically combined to MDA-MB-231 breast cancer cell; upon confocal microscopy observation, the fluorescence of the FITC-PTS is mainly concentrated in cytoplasm; and based on in vivo near-infrared fluorescence imaging technique, Cy5.5-PTS probe high signal is detected in alpha-v-beta-3 positive MDA-MB-231 tumor.

Description

technical field [0001] The invention belongs to the technical field of molecular biology, and in particular relates to a small peptide and its application as a targeting contrast agent and an antitumor drug carrier. Background technique [0002] Tumor-specific cell surface receptors can attract targeting molecules, enabling the design and development of tumor cell-selective agents for the diagnosis and treatment of tumors. Many tumor receptor targeting peptides serve as active targeting vehicles. In previous studies, we extracted P1c peptide (CIRTPKISKPIKFELSG) from human connective tissue growth factor CTGF, which can specifically bind to human integrin avβ3. At the same time, using superparamagnetic iron oxide USPIOs, this peptide was successfully applied to the nuclear magnetic resonance (MRI) examination of primary liver cancer Bel 7402 with positive expression of αvβ3. [0003] Antimicrobial peptides are extracted from synthetic or natural peptides and proteins, most ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/00A61K49/00A61K47/42
CPCC07K14/00A61K47/42A61K49/00
Inventor 吴国球
Owner SOUTHEAST UNIV
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More