Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Epitope polypeptide applicable to mycobacterium tuberculosis infection detection and application thereof

A technology of mycobacterium tuberculosis and antigenic epitopes, applied in the fields of peptides, biological tests, antibacterial drugs, etc., can solve the problems of high cost, unsuitability, and inapplicability for widespread promotion

Active Publication Date: 2012-06-27
INST OF MICROBIOLOGY - CHINESE ACAD OF SCI
View PDF0 Cites 15 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0006] However, due to the protection of patent rights, the cost of introducing related products for clinical diagnosis in my country is extremely high and it is not suitable for the special epidemiological situation in my country, and it is not suitable for widespread promotion, and the diagnosis using ESAT-6 and CFP-10 as antigens It is difficult for reagent development to escape the patent protection of these two antigens

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Epitope polypeptide applicable to mycobacterium tuberculosis infection detection and application thereof
  • Epitope polypeptide applicable to mycobacterium tuberculosis infection detection and application thereof
  • Epitope polypeptide applicable to mycobacterium tuberculosis infection detection and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0023] Embodiment 1 can be used for the antigen that Mycobacterium tuberculosis detects

[0024] Mycobacterium tuberculosis specific antigen Rv3615c, its amino acid composition is shown in SEQ ID NO.10.

[0025] SEQ ID NO.10:

[0026] MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLT

[0027] AHNALGS SLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT

Embodiment 2

[0028] Example 2 Polypeptides that can be used for Mycobacterium tuberculosis detection

[0029] The amino acid sequence of the polypeptide is a polypeptide composed of 8-11 consecutive amino acids in the antigen Rv3615c, as shown in the following table, preferably such as SEQ-ID-NO.1, SEQ-ID-NO.2, SEQ-ID-NO .5, shown in SEQ-ID-NO.6, SEQ-ID-NO.7.

[0030] Table 1. Epitope peptide information:

[0031]

Embodiment 3

[0032] Embodiment 3 antigen is applied to the development of detection kit

[0033] The antigen protected by this patent can be used for the diagnosis of Mycobacterium tuberculosis infection, forming a kit for clinical or laboratory diagnosis.

[0034] The test kit contains:

[0035] 1. A mixed polypeptide peptide library composed of one or several polypeptides in Example 2;

[0036] 2. Phytohemagglutinin (PHA) solution positive control stimulus;

[0037] 3. ELISPOT96-well PVDF membrane plate;

[0038] 4. Human γ-interferon monoclonal antibody (primary antibody), biotin-labeled human γ-interferon monoclonal antibody (secondary antibody), horseradish peroxidase-labeled streptavidin and horseradish peroxidation enzyme reaction substrate;

[0039] 5. Other reagents and consumables required for ELISPOT detection.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses certain mycobacterium tuberculosis specific antigen epitope polypeptides, and particularly discloses an antigen Pv3615c antigen epitope polypeptide consisting of 8-11 continuous polypeptide fragments. The clinical detection practicability of the antigen polypeptide is evaluated according to the reaction sensitivity and specificity of the antigen polypeptide in a tuberculosis case. As proved by a result, an antigen polypeptide has high T cell reactivity in a tuberculosis patient, and the positive rate is up to 64 percent (9 / 14). Compared with the result of a healthy volunteer, the antigen epitope polypeptide has the specificity of up to 100 percent (6 / 6). Mycobacterium tuberculosis infection can be diagnosed effectively by applying an antigen peptide library specific T cell gamma interferon.

Description

technical field [0001] The present invention relates to Mycobacterium tuberculosis specific antigen epitope polypeptide, especially the antigen epitope polypeptide of antigen Rv3615c. Background technique [0002] Tuberculosis is an infectious disease caused by Mycobacterium tuberculosis. According to WHO estimates, one-third of the world's population is infected by Mycobacterium tuberculosis. There are more than nine million new cases of active infection and more than one million deaths each year. In recent years, the incidence of tuberculosis in my country has remained high, with more than one million new cases and nearly 200,000 deaths each year, which has seriously harmed the health of our citizens, social stability and economic development. [0003] Early diagnosis of tuberculosis is of great significance in controlling the progression of the disease in patients and the spread of the disease. At present, the clinical diagnosis of tuberculosis still lacks high-sensitivi...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K7/06C12N15/63C12N5/10C12N1/00G01N33/68C12Q1/68A61K38/08A61K48/00A61P31/06
Inventor 高福谭曙光
Owner INST OF MICROBIOLOGY - CHINESE ACAD OF SCI
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products