New uses of lymphotoxin derivatives
A technology of lymphotoxins and derivatives, which is applied in the direction of medical preparations containing active ingredients, anti-toxins, drug combinations, etc., and can solve problems such as incomplete application research, lack of protective means and treatment methods, capillary leakage, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0038] Example 1 Preparation of LT008
[0039] It is prepared according to the process of Example 1 of the patent document with the publication number CN101084238B, and its amino acid sequence (SEQID NO:1) is:
[0040] MHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSEYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL.
Embodiment 2
[0041] Example 2 LT008 can promote the recovery of wild-type C57BL / 6 mice from nuclear radiation damage in vivo
[0042] 2.1 Research methods
[0043] Wild C57BL / 6 mice were quarantined and reared in the SPF animal room for 3 weeks after they were purchased. After weighing them with a BS124 balance before grouping, they were numbered and marked by the ear tag method and randomly grouped according to their body weight. Divided into PBS control group (W1) and LT008 group (W2), each with 20 animals, half of the male and the female, for the survival rate determination. In addition, PBS control group (W3) and LT008 group (W4) were used, each with 60 animals, half male and female, for the study of blood picture, bone marrow cytology, bone marrow pathology and related mechanisms.
[0044] All mice in the LT group were given 250μg / kg LT008 via tail vein injection for three consecutive days after 75% alcohol disinfection two days before and on the day of irradiation. The administration conc...
Embodiment 3
[0059] Example 3 The protective effect of LT008 on human monocyte THP-1 damage caused by nuclear radiation in vitro
[0060] 3.1 LT008 can promote the proliferation of THP-1 cells and promote the survival of THP-1 cells under irradiation
[0061] (1) Method: Different concentrations of LT008 (0, 0.1, 1, 10 and 50μg / mL) were treated with THP-1 cells for different times (0, 1, 4, 8, 24, 48 and 72 hours) and then counted To make the cell proliferation curve; after the above-mentioned different concentrations of LT008 are applied to the cells, the total amount of 6Gy 60Co-γ irradiation (1.63Gy / min) is performed immediately, and the cells are processed for 0, 1, 4, 8, 24, 48, 72h Count and make cell proliferation curve. See the result Figure 13 .
[0062] (2) Test result: the result is as Figure 13 As shown in A, compared with the control group, the cell number of cells treated with 0-10μg / mL LT008 did not change significantly at different times, but the number of THP-1 cells began to...
PUM
![No PUM](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka-patsnap-com.libproxy1.nus.edu.sg/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap