Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Monomeric and dimeric fluorescent protein variants and methods for making same

a fluorescent protein and monomer technology, applied in the field of anthozoan fluorescent proteins, can solve the problems of dsred tetramerization being difficult in some cases to confirm whether, affecting the development of the protein, etc., and achieve the effect of improving fluoresence intensity or fluorescence maturation

Inactive Publication Date: 2006-01-05
RGT UNIV OF CALIFORNIA
View PDF6 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

[0015] In one aspect, the invention concerns an Anthozoan fluorescent protein (AnFP) having a reduced propensity to oligomerize, comprising at least one mutation within the wild-type AnFP amino acid sequence that reduces or eliminates the ability of the fluorescent protein to tetramerize and / or dimerize, as the case may be. The AnFP preferably is the red fluorescent protein of Discosoma (DsRed) of SEQ ID NO: 1, but is by no means so limited. In some embodiments, the invention concerns an Anthozoan fluorescent protein (AnFP), e.g., DsRed, comprising at least one amino acid substitution within the AB and / or AC interface of said fluorescent protein (e.g., DsRed) that reduces or eliminates the degree of oligomerization of said fluorescent protein.
[0018] In a particular embodiment, the fluorescent protein is DsRed, and a DsRed variant having a reduced propensity to oligomerize (in this case, tetramerize) is prepared by first replacing at least one key residue in the AC and / or AB interface of the wild-type protein, thereby creating a dimer or monomer form, followed by the introduction of further mutation(s) to restore or improve red fluorescence properties.
[0037] In some embodiments, this method can result in dimeric or monomeric variants has improved fluoresence intensity or fluorescence maturation relative to the non-mutagenized fluorescent protein.

Problems solved by technology

While the weak dimerization of Aequorea GFP has not impeded its acceptance as an indispensable tool of cell biology, the obligate tetramerization of DsRed has greatly hindered its development from a scientific curiosity to a generally applicable and robust tool, most notably as genetically encoded fusion tag.
DsRed tetramerization presents an obstacle for the researcher who wishes to image the subcellular localization of a red fluorescent chimera, as the question exists as to what extent will fusing tetrameric DsRed to the protein of interest affect the location and function of the latter.
Furthermore, it can be difficult in some cases to confirm whether a result is due, for example, to a specific interaction of two proteins under investigation, or whether a perceived interaction is an artifact caused by the oligomerization of fluorescent proteins linked to each of the two proteins under investigation.
However, the fundamental problem of tetramerization has yet to be overcome.
4) making the protein problematic to use in experimental systems.
However this variant appears to still suffer from an incomplete maturation and therefore like DsRed, a significant fraction of the protein remains as the green fluorescent intermediate in the aged tetramer.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Monomeric and dimeric fluorescent protein variants and methods for making same
  • Monomeric and dimeric fluorescent protein variants and methods for making same
  • Monomeric and dimeric fluorescent protein variants and methods for making same

Examples

Experimental program
Comparison scheme
Effect test

example 1

[0160] Construction of Dimeric and Monomeric Red Flourescent Proteins

Materials and Methods

DsRed Mutagenesis and Screening

[0161] The DsRed gene was amplified from vector pDsRed-N1 (CLONTECH, Palo Alto, Calif.) or the T1 variant (provided by B. S. Glick, University of Chicago) and subcloned into PRSETB (Invitrogen™; see Baird et al., Proc. Natl. Acad. Sci. USA 97:11984-11989 [2000]) (4). The PRSETB vector produces 6×His tagged fusion proteins, where an N-terminal polyhistidine tag having the following sequence is coupled to the suitably subcloned sequence.

MRGSHHHHHGMASMTGGQQMGRDLYDDDDKDP(SEQ ID NO: 22)

[0162] This resulting construct was used as the template for introduction of the I125R mutant using the QuikChange™ Site Directed Mutagenesis Kit (Stratagene®), according to the manufacturer's instructions. The complete DsRed wild-type cDNA and polypeptide sequences are provided in GenBank Accession Number AF168419. This nucleotide sequence is also provided in FIG. 16 and SEQ ID N...

example 2

[0215] Preparation And Characterization Of Fluorescent Protein Variants

[0216] This example demonstrates that mutations can be introduced into GFP spectral variants that reduce or eliminate the ability of the proteins to oligomerize.

[0217] ECFP (SEQ ID NO: 14) and EYFP-V68L / Q69K (SEQ ID NO: 12) at the dimer interface were subcloned into the bacterial expression vector PRSETB (Invitrogen Corp., La Jolla Calif.), creating an N-terminal His6 tag on the of ECFP (SEQ ID NO: 14) and EYFP-V68L / Q69K (SEQ ID NO: 12), which allowed purification of the bacterially expressed proteins on a nickel-agarose (Qiagen) affinity column. All dimer-related mutations in the cDNAs were created by site-directed mutagenesis using the QuickChange mutagenesis kit (Stratagene), then expressed and purified in the same manner. All cDNAs were sequenced to ensure that only the desired mutations existed.

[0218] EYFP-V68L / Q69K (SEQ ID NO: 12) was mutagenized using the QuickChange kit (Stratagene). The overlapping mu...

example 3

[0229] Characterization of the Coral Red Fluorescent Protein, DsRed, and Mutants Thereof

[0230] This example describes the initial biochemical and biological characterization of DsRed and DsRed mutants.

[0231] The coding sequence for DsRed was amplified from pDsRed-N1 (Clontech Laboratories) with PCR primers that added an N terminal BamHI recognition site upstream of the initiator Met codon and a C terminal Eco RI site downstream of the STOP codon. After restriction digestion, the PCR product was cloned between the Bam HI and Eco RI sites of PRSETB (Invitrogen), and the resulting vector was amplified in DH5α bacteria. The resulting plasmid was used as a template for error-prone PCR (Heim and Tsien, Curr. Biol. 6:178-182, 1996, which is incorporated herein by reference) using primers that were immediately upstream and downstream of the DsRed coding sequence, theoretically allowing mutation of every coding base, including the initiator Met. The mutagenized PCR fragment was digested wi...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
molecular weightaaaaaaaaaa
molecular weightaaaaaaaaaa
apparent molecular weightaaaaaaaaaa
Login to View More

Abstract

The present invention relates generally to variant fluorescent proteins, and more specifically to monomeric and dimeric forms of Anthozoan fluorescent proteins. In one aspect, the present invention provides variants of fluorescent proteins, where the variants have a reduced propensity to tetramerize, and form dimeric or monomerc structures. The invention also relates to methods of making and using such fluorescent protein monomers and dimers.

Description

[0001] This application is a continuation-in-part application claiming priority under 35 U.S.C. § 120 to copending U.S. patent application Ser. No. 09 / 866,538, filed May 24, 2001, which is a continuation-in-part application claiming priority under 35 U.S.C. § 120 to copending U.S. patent application Ser. No. 09 / 794,308, filed Feb. 26, 2001, each of which are hereby incorporated by reference in their entirety.[0002] This invention was made in part with Government support under Grant No. NS27177, awarded by the National Institute of Neurological Disorders and Stroke, and under Grant No. GM62114-01, awarded by the National Institute of General Medical Sciences. The Government may have certain rights in this invention.BACKGROUND OF THE INVENTION [0003] 1. Field of the Invention [0004] The present invention relates generally to variant fluorescent proteins, and more specifically to Anthozoan fluorescent proteins that have a reduced propensity to oligomerize, where such proteins form mono...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(United States)
IPC IPC(8): C07H21/04C12P21/06C07K14/435G01N33/50C07K14/47C07K19/00C12N1/15C12N1/19C12N1/21C12N5/10C12N15/09C12Q1/02C12Q1/25C12Q1/68G01N21/78G01N21/80G01N33/15G01N33/53G01N33/542G01N33/58G01N33/84
CPCC07K14/43504C07K14/43595G01N2500/02G01N33/585G01N33/84C12Q1/25
Inventor TSIEN, ROGERCAMPBELL, ROBERT
Owner RGT UNIV OF CALIFORNIA
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More